Dbfetch

ID   EF488367; SV 1; linear; genomic DNA; STD; HUM; 1789 BP.
XX
AC   EF488367;
XX
DT   19-APR-2007 (Rel. 91, Created)
DT   03-NOV-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*new allele, exons 1
DE   through 8 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1789
RX   DOI; 10.1111/j.1399-0039.2008.01123.x.
RX   PUBMED; 18764807.
RA   Caggiari L., Cannizzaro R., De Zorzi M., Canzonieri V., Da Ponte A.,
RA   De Re V.;
RT   "A new HLA-A*680106 allele identified in individuals with celiac disease
RT   from the Friuli area of northeast Italy";
RL   Tissue Antigens 72(5):491-492(2008).
XX
RN   [2]
RP   1-1789
RA   De Re V., Caggiari L., De Zorzi M.;
RT   ;
RL   Submitted (09-MAR-2007) to the INSDC.
RL   DOMERT, Centro Di Riferimento Oncologico, IRCCS, F. Gallini, 2, Aviano, PN
RL   33081, Italy
XX
DR   MD5; da9f7b910dc70bb6d94e2357049547c3.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1789
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1789
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*new"
FT   mRNA            join(<1..64,165..434,535..810,911..1186,1287..1403,
FT                   1504..1536,1637..1684,1785..>1789)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*new"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..64,165..434,535..810,911..1186,1287..1403,
FT                   1504..1536,1637..1684,1785..1789)
FT                   /codon_start=1
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*new"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:A4UTT5"
FT                   /db_xref="IMGT/HLA:A*68:01:06"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:A4UTT5"
FT                   /protein_id="ABP02054.1"
FT                   /translation="MAPRTLVLLLSGALALTQTWAGSHSMRYFYTSVSRPGRGEPRFIA
FT                   VGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDRNTRNVKAQSQTDRVDLGTLRG
FT                   YYNQSEAGSHTIQMMYGCDVGSDGRFLRGYRQDAYDGKDYIALKEDLRSWTAADMAAQT
FT                   TKHKWEAAHVAEQWRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEATL
FT                   RCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWVAVVVPSGQEQRYTCH
FT                   VQHEGLPKPLTLRWEPSSQPTIPIVGIIAGLVLFGAVITGAVVAAVMWRRKSSDRKGGS
FT                   YSQAASSDSAQGSDVSLTACKV"
FT   exon            <1..64
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*new"
FT                   /number=1
FT   gap             65..164
FT                   /estimated_length=unknown
FT   exon            165..434
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*new"
FT                   /number=2
FT   gap             435..534
FT                   /estimated_length=unknown
FT   exon            535..810
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*new"
FT                   /number=3
FT   gap             811..910
FT                   /estimated_length=unknown
FT   exon            911..1186
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*new"
FT                   /number=4
FT   gap             1187..1286
FT                   /estimated_length=unknown
FT   exon            1287..1403
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*new"
FT                   /number=5
FT   gap             1404..1503
FT                   /estimated_length=unknown
FT   exon            1504..1536
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*new"
FT                   /number=6
FT   gap             1537..1636
FT                   /estimated_length=unknown
FT   exon            1637..1684
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*new"
FT                   /number=7
FT   gap             1685..1784
FT                   /estimated_length=unknown
FT   exon            1785..>1789
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*new"
FT                   /number=8
XX
SQ   Sequence 1789 BP; 218 A; 320 C; 368 G; 183 T; 700 other;
     atggcgcccc gaaccctcgt cctgctactc tcgggggccc tggccctgac ccagacctgg        60
     gcggnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       120
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnngctccc actccatgag       180
     gtatttctac acttccgtgt cccggcctgg ccgcggggag ccccgcttca tcgccgtggg       240
     ctacgtggac gacacgcagt tcgtgcggtt cgacagcgac gccgcgagcc agaggatgga       300
     gccgcgggcg ccgtggatag agcaggaggg gccggagtat tgggaccgga acacacggaa       360
     tgtgaaggcc cagtcacaga ctgaccgagt ggacctgggg accctgcgcg gctactacaa       420
     ccagagcgag gccgnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnngttctc       540
     acaccatcca gatgatgtat ggctgcgacg tggggtcgga cgggcgcttc ctccgcgggt       600
     accggcagga cgcctacgac ggcaaggatt acatcgccct gaaagaggac ctgcgctctt       660
     ggaccgcggc ggacatggca gctcagacca ccaagcacaa gtgggaggcg gcccatgtgg       720
     cggagcagtg gagagcctac ctggagggca cgtgcgtgga gtggctccgc agatacctgg       780
     agaacgggaa ggagacgctg cagcgcacgg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       840
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       900
     nnnnnnnnnn acgcccccaa aacgcatatg actcaccacg ctgtctctga ccatgaagcc       960
     accctgaggt gctgggccct gagcttctac cctgcggaga tcacactgac ctggcagcgg      1020
     gatggggagg accagaccca ggacacggag ctcgtggaga ccaggcctgc aggggatgga      1080
     accttccaga agtgggtggc tgtggtggtg ccttctggac aggagcagag atacacctgc      1140
     catgtgcagc atgagggttt gcccaagccc ctcaccctga gatgggnnnn nnnnnnnnnn      1200
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1260
     nnnnnnnnnn nnnnnnnnnn nnnnnnagcc gtcttcccag cccaccatcc ccatcgtggg      1320
     catcattgct ggcctggttc tctttggagc tgtgatcact ggagctgtgg tcgctgctgt      1380
     gatgtggagg aggaagagct cagnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1440
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1500
     nnnatagaaa aggagggagc tactctcagg ctgcaannnn nnnnnnnnnn nnnnnnnnnn      1560
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1620
     nnnnnnnnnn nnnnnngcag tgacagtgcc cagggctctg atgtgtctct cacagcttgt      1680
     aaagnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1740
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnntgtga                  1789
//