Dbfetch

ID   EF486279; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   EF486279;
XX
DT   14-MAY-2007 (Rel. 91, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*40new allele, exon 2
DE   and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RX   DOI; 10.1111/j.1399-0039.2007.00989.x.
RX   PUBMED; 18194363.
RA   Wang D., Zhang Z.;
RT   "Characterization of the novel allele HLA-B*4075";
RL   Tissue Antigens 71(3):251-252(2008).
XX
RN   [2]
RP   1-270
RA   Wang L., Shan X., Ni L., Wang Z., Cui S., Liu N., Li W., He X., Wang L.,
RA   Zhao B., Gong Z., Zhang Z.;
RT   "A novel allele HLA-B*40 identified by sequence-based typing";
RL   Unpublished.
XX
RN   [3]
RP   1-270
RA   Wang L., Shan X., Ni L., Wang Z., Cui S., Liu N., Li W., He X., Wang L.,
RA   Zhao B., Gong Z., Zhang Z.;
RT   ;
RL   Submitted (07-MAR-2007) to the INSDC.
RL   HLA Lab, Beijing Red Cross Blood Center, No.37 North Third Ring Road,
RL   Beijing 100088, China
XX
DR   MD5; 09360c1fb9f18a3fa225443b90e2a1d3.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40new"
FT   mRNA            <1..>270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40new"
FT                   /product="MHC class I antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40new"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:A5HDH5"
FT                   /db_xref="IMGT/HLA:B*40:75"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:A5HDH5"
FT                   /protein_id="ABQ23498.1"
FT                   /translation="SHSMRYFHTSVSRPGRGEPRFITVGYVDDTLFVRFDSDATSPRKE
FT                   PRAPWIEQEGPEYWDRETQICKTNTQTYRESLRNLRGYYNQSEA"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40new"
FT                   /number=2
FT   variation       199
FT                   /gene="HLA-B"
FT                   /replace="c"
FT                   /note="compared with HLA-B*40"
XX
SQ   Sequence 270 BP; 59 A; 86 C; 89 G; 36 T; 0 other;
     gctcccactc catgaggtat ttccacacct ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcac cgtgggctac gtggacgaca cgctgttcgt gaggttcgac agcgacgcca       120
     cgagtccgag gaaggagccg cgggcgccat ggatagagca ggaggggccg gagtattggg       180
     accgggagac acagatctgc aagaccaaca cacagactta ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg                                        270
//