spacer

EBI Dbfetch

ID   EF472970; SV 1; linear; genomic DNA; STD; HUM; 276 BP.
XX
AC   EF472970;
XX
DT   14-MAY-2007 (Rel. 91, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 2)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*37new allele, exon 3
DE   and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-276
RA   Ni L., Shan X., Wang Z., Wang L., Li W., He X., Liu N., Wang L., Cui S.,
RA   Gong Z., Zhao B., Zhang Z.;
RT   "A novel allele HLA-B*37 identified by sequence-based typing";
RL   Unpublished.
XX
RN   [2]
RP   1-276
RA   Ni L., Shan X., Wang Z., Wang L., Li W., He X., Liu N., Wang L., Cui S.,
RA   Gong Z., Zhao B., Zhang Z.;
RT   ;
RL   Submitted (07-MAR-2007) to the INSDC.
RL   HLA Lab, Beijing Red Cross Blood Center, No.37 North Third Ring Road,
RL   Beijing 100088, China
XX
DR   MD5; 80ba0416a6b946a2f793fe1d21c6d001.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..276
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>276
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*37new"
FT   mRNA            <1..>276
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*37new"
FT                   /product="MHC class I antigen"
FT   CDS             <1..>276
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*37new"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:A5HC73"
FT                   /db_xref="IMGT/HLA:B*37:13"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:A5HC73"
FT                   /protein_id="ABQ23497.1"
FT                   /translation="SHTIQRMSGCDVGPDGRLLRGYNQFAYDGKDYIALNEDLSSWTAA
FT                   DTAAQITQRKWEAAREAEQDRAYLEGTCVEWLRRYLENGKETLQRA"
FT   exon            1..276
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*37new"
FT                   /number=3
FT   variation       184
FT                   /gene="HLA-B"
FT                   /replace="t"
FT                   /note="compared with HLA-B*37"
XX
SQ   Sequence 276 BP; 55 A; 84 C; 102 G; 35 T; 0 other;
     ggtctcacac catccagagg atgtctggct gcgacgtggg gccggacggg cgcctcctcc        60
     gcgggtataa ccagttcgcc tacgacggca aggattacat cgccctgaac gaggacctga       120
     gctcctggac cgcggcggac accgcggctc agatcaccca gcgcaagtgg gaggcggccc       180
     gtgaggcgga gcaggacaga gcctacctgg agggcacgtg cgtggagtgg ctccgcagat       240
     acctggagaa cgggaaggag acgctgcagc gcgcgg                                 276
//


spacer
spacer