spacer

EBI Dbfetch

ID   EF472969; SV 1; linear; genomic DNA; STD; HUM; 276 BP.
XX
AC   EF472969;
XX
DT   14-MAY-2007 (Rel. 91, Created)
DT   07-APR-2013 (Rel. 116, Last updated, Version 3)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*07new allele, exon 3
DE   and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-276
RX   PUBMED; 23278383.
RA   Liu N., Zhang Z., Shan X., Wang L., Cui S.;
RT   "A novel HLA-B allele, B*07:55, identified by sequence-based typing";
RL   Tissue Antigens 81(2):121-123(2013).
XX
RN   [2]
RP   1-276
RA   Li W., Shan X., Liu N., Ni L., Wang L., Wang L., Cui S., Wang Z., He X.,
RA   Gong Z., Zhao B., Zhang Z.;
RT   "A novel allele HLA-B*07 identified by sequence-based typing";
RL   Unpublished.
XX
RN   [3]
RP   1-276
RA   Li W., Shan X., Liu N., Ni L., Wang L., Wang L., Cui S., Wang Z., He X.,
RA   Gong Z., Zhao B., Zhang Z.;
RT   ;
RL   Submitted (07-MAR-2007) to the INSDC.
RL   HLA Lab, Beijing Red Cross Blood Center, No.37 North Third Ring Road,
RL   Beijing 100088, China
XX
DR   MD5; e1b55c33465e1af2b1718c9519a7f97c.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..276
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>276
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*07new"
FT   mRNA            <1..>276
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*07new"
FT                   /product="MHC class I antigen"
FT   CDS             <1..>276
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*07new"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:A5HC72"
FT                   /db_xref="IMGT/HLA:B*07:55"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:A5HC72"
FT                   /protein_id="ABQ23496.1"
FT                   /translation="SHTLQSMYGCDVGPDGRLLRGHDQYAYDGKDYIALNEDLRSWTAA
FT                   DTAAQITQRKWEAAREAEQWRAYLEGECVEWLRRYLENGKDKLERA"
FT   exon            1..276
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*07new"
FT                   /number=3
FT   variation       195
FT                   /gene="HLA-B"
FT                   /replace="c"
FT                   /note="compared with HLA-B*07"
XX
SQ   Sequence 276 BP; 54 A; 85 C; 103 G; 34 T; 0 other;
     ggtctcacac cctccagagc atgtacggct gcgacgtggg gccggacggg cgcctcctcc        60
     gcgggcatga ccagtacgcc tacgacggca aggattacat cgccctgaac gaggacctgc       120
     gctcctggac cgccgcggac acggcggctc agatcaccca gcgcaagtgg gaggcggccc       180
     gtgaggcgga gcagtggaga gcctacctgg agggcgagtg cgtggagtgg ctccgcagat       240
     acctggagaa cgggaaggac aagctggagc gcgctg                                 276
//


spacer
spacer