Dbfetch

ID   EF472968; SV 1; linear; genomic DNA; STD; HUM; 276 BP.
XX
AC   EF472968;
XX
DT   14-MAY-2007 (Rel. 91, Created)
DT   07-APR-2013 (Rel. 116, Last updated, Version 3)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*13new allele, exon 3
DE   and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-276
RX   PUBMED; 23278360.
RA   Liu N., Zhang Z., Shan X., Cui S., Zhao B.;
RT   "A novel HLA-B allele, B*13:18, identified by sequence-based typing";
RL   Tissue Antigens 81(2):123-124(2013).
XX
RN   [2]
RP   1-276
RA   Liu N., Shan X., Li W., Wang L., He X., Wang Z., Ni L., Cui S., Wang L.,
RA   Gong Z., Zhao B., Zhang Z.;
RT   "A novel allele HLA-B*13 identified by sequence-based typing";
RL   Unpublished.
XX
RN   [3]
RP   1-276
RA   Liu N., Shan X., Li W., Wang L., He X., Wang Z., Ni L., Cui S., Wang L.,
RA   Gong Z., Zhao B., Zhang Z.;
RT   ;
RL   Submitted (07-MAR-2007) to the INSDC.
RL   HLA Lab, Beijing Red Cross Blood Center, No.37 North Third Ring Road,
RL   Beijing 100088, China
XX
DR   MD5; a0b62c466b26e45570a3b59b775a944f.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..276
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>276
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*13new"
FT   mRNA            <1..>276
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*13new"
FT                   /product="MHC class I antigen"
FT   CDS             <1..>276
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*13new"
FT                   /product="MHC class I antigen"
FT                   /db_xref="IMGT/HLA:B*13:18"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:A5HC71"
FT                   /protein_id="ABQ23495.1"
FT                   /translation="SHTWQTMYGCDLGPDGRLLRGHNQLAYDGKDYIALNEDLSSWTAA
FT                   DTAAQITQLKWEAARVAEQRRAYLEGECVEWLRRYLENGKETLQRA"
FT   exon            1..276
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*13new"
FT                   /number=3
FT   variation       196
FT                   /gene="HLA-B"
FT                   /replace="t"
FT                   /note="compared with HLA-B*13"
XX
SQ   Sequence 276 BP; 54 A; 82 C; 103 G; 37 T; 0 other;
     ggtctcacac ttggcagacg atgtatggct gcgacctggg gccggacggg cgcctcctcc        60
     gcgggcataa ccagttagcc tacgacggca aggattacat cgccctgaac gaggacctga       120
     gctcctggac cgcggcggac accgcggctc agatcaccca gctcaagtgg gaggcggccc       180
     gtgtggcgga gcagcggaga gcctacctgg agggcgagtg cgtggagtgg ctccgcagat       240
     acctggagaa cgggaaggag acgctgcagc gcgcgg                                 276
//