spacer

EBI Dbfetch

ID   EF471993; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   EF471993;
XX
DT   08-MAY-2007 (Rel. 91, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 2)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*54New allele, exon 2
DE   and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Zhang D., Li L., Feng G.;
RT   "A novel allele HLA-B*54 identified by sequence-based typing";
RL   Unpublished.
XX
RN   [2]
RP   1-270
RA   Zhang D., Li L., Feng G.;
RT   ;
RL   Submitted (06-MAR-2007) to the INSDC.
RL   HLA Lab., Taiyuan Red Cross Blood Center, No.185 Taiyuan Yingze West
RL   Street, Taiyuan, Shanxi 030024, China
XX
DR   MD5; 17ee8ac07fa95342c8b38647495e7d81.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="2q33"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*54New"
FT   mRNA            <1..>270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*54New"
FT                   /product="MHC class I antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*54New"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:A5HC28"
FT                   /db_xref="IMGT/HLA:B*54:12"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:A5HC28"
FT                   /protein_id="ABQ10633.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRGE
FT                   PRAPWVEQEGPEYWDRNTQIYKAQAQTDRENLRIALRYYNQSEA"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*54New"
FT                   /number=2
FT   variation       229
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*54"
FT                   /replace="g"
FT   variation       238
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*54"
FT                   /replace="a"
FT   variation       240
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*54"
FT                   /replace="c"
FT   variation       241
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*54"
FT                   /replace="t"
FT   variation       244
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*54"
FT                   /replace="g"
FT   variation       246
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*54"
FT                   /replace="g"
XX
SQ   Sequence 270 BP; 54 A; 87 C; 94 G; 35 T; 0 other;
     gctcccactc catgaggtat ttctacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagtccgag aggggagccg cgggcgccgt gggtggagca ggaggggccg gagtattggg       180
     accggaacac acagatctac aaggcccagg cacagactga ccgagagaac ctgcggatcg       240
     cgctccgcta ctacaaccag agcgaggccg                                        270
//


spacer
spacer