spacer

EBI Dbfetch

ID   EF471361; SV 1; linear; genomic DNA; STD; HUM; 1959 BP.
XX
AC   EF471361;
XX
DT   09-APR-2007 (Rel. 91, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 2)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*5815 allele, exons 1
DE   through 5 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1959
RA   Sikorski P.M., Eller S.R., Iglehart B.S., Leffell M.S.;
RT   ;
RL   Submitted (06-MAR-2007) to the INSDC.
RL   Medicine, Johns Hopkins University, 2041 E. Monument St, Baltimore, MD
RL   21205, USA
XX
DR   MD5; 427f3fbae081e2acb96897c0fad83ef9.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1959
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1959
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5815"
FT   mRNA            join(<1..48,178..447,693..968,1544..1819,1924..>1959)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5815"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..48,178..447,693..968,1544..1819,1924..>1959)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5815"
FT                   /product="MHC class I antigen"
FT                   /note="major histocompatibility complex; human leukocyte
FT                   antigen B locus"
FT                   /db_xref="GOA:A4URH7"
FT                   /db_xref="IMGT/HLA:B*58:15"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:A4URH7"
FT                   /protein_id="ABO86194.1"
FT                   /translation="LLLLWGAVALTETWAGSHSMRYFYTAMSRPGRGEPRFIAVGYVDD
FT                   TQFVRFDSDAASPRTEPRAPWIEQEGPEYWDGETRNMKASAQTYPENLRIALRYYNQSE
FT                   AGSHIIQRMYGCDLGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWE
FT                   AARVAEQLRAYLEGLCVEWLRRYLENGKETLQRADPPKTHVTHHPVSDHEATLRCWALG
FT                   FYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGL
FT                   PKPLTLRWEPSSQSTIPIVG"
FT   exon            <1..48
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5815"
FT                   /number=1
FT   exon            178..447
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5815"
FT                   /number=2
FT   exon            693..968
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5815"
FT                   /number=3
FT   exon            1544..1819
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5815"
FT                   /number=4
FT   exon            1924..>1959
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5815"
FT                   /number=5
XX
SQ   Sequence 1959 BP; 365 A; 611 C; 639 G; 344 T; 0 other;
     tcctcctgct gctctggggg gcagtggccc tgaccgagac ctgggccggt gagtgcgggg        60
     tcgggaggga aatggcctct gtggggagga gcgaggggac cgcaggcggg ggcgcaggac       120
     ctgaggagcc gcgccgggag gagggtcggg cgggtctcag cccctcctcg cccccaggct       180
     cccactccat gaggtatttc tacaccgcca tgtcccggcc cggccgcggg gagccccgct       240
     tcatcgcagt gggctacgtg gacgacaccc agttcgtgag gttcgacagc gacgccgcga       300
     gtccgaggac ggagccccgg gcgccatgga tagagcagga ggggccggag tattgggacg       360
     gggagacacg gaacatgaag gcctccgcgc agacttaccc agagaacctg cggatcgcgc       420
     tccgctacta caaccagagc gaggccggtg agtgaccccg gcccggggcg caggtcacga       480
     ctccccatcc cccacgtacg gcccgggtcg ccccgagtct ccgggtccga gatccgcctc       540
     cctgaggccg cgggacccgc ccagaccctc gaccggcgag agccccaggc gcgtttaccc       600
     ggtttcattt tcagttgagg ccaaaatccc cgcgggttgg tcggggcggg gcggggctcg       660
     ggggacgggg ctgaccgcgg ggccggggcc agggtctcac atcatccaga ggatgtatgg       720
     ctgcgacctg gggcccgacg ggcgcctcct ccgcgggcat gaccagtccg cctacgacgg       780
     caaggattac atcgccctga acgaggacct gagctcctgg accgcggcgg acaccgcggc       840
     tcagatcacc cagcgcaagt gggaggcggc ccgtgtggcg gagcagctga gagcctacct       900
     ggagggcctg tgcgtggagt ggctccgcag atacctggag aacgggaagg agacgctgca       960
     gcgcgcgggt accaggggca gtggggagcc ttccccatct cctataggtc gccggggatg      1020
     gcctcccacg agaagaggag gaaaatggga tcagcgctag aatgtcgccc tcccttgaat      1080
     ggagaatggc atgagttttc ctgagtttcc tctgagggcc ccctcttctc tctaggacaa      1140
     ttaagggatg acgtctctga ggaaatggag gggaagacag tccctagaat actgatcagg      1200
     ggtccccttt gacccctgca gcagccttgg gaaccgtgac ttttcctctc aggccttgtt      1260
     ctctgcctca cactcagtgt gtttggggct ctgattccag cacttctgag tcactttacc      1320
     tccactcaga tcaggagcag aagtccctgt tccccgctca gagactcgaa ctttccaatg      1380
     aataggagat tatcccaggt gcctgcgtcc aggctggtgt ctgggttctg tgccccttcc      1440
     ccacaccagg tgtcctgtcc attctcaggc tggtcacatg ggtggtccta gggtgtccca      1500
     tgagagatgc aaagcgcctg aattttctga ctcttcccat cagacccccc aaagacacac      1560
     gtgacccacc accccgtctc tgaccatgag gccaccctga ggtgctgggc cctgggcttc      1620
     taccctgcgg agatcacact gacctggcag cgggatggcg aggaccaaac tcaggacact      1680
     gagcttgtgg agaccagacc agcaggagat agaaccttcc agaagtgggc agctgtggtg      1740
     gtgccttctg gagaagagca gagatacaca tgccatgtac agcatgaggg gctgccgaag      1800
     cccctcaccc tgagatgggg taaggagggg gatgaggggt catatctctt ctcagggaaa      1860
     gcaggagccc ttctggagcc cttcagcagg gtcagggccc ctcgtcttcc cctcctttcc      1920
     cagagccatc ttcccagtcc accatcccca tcgtgggca                             1959
//


spacer
spacer