Dbfetch

ID   EF471360; SV 1; linear; genomic DNA; STD; HUM; 2024 BP.
XX
AC   EF471360;
XX
DT   09-APR-2007 (Rel. 91, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 2)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*320102 allele, exons 1
DE   through 5 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-2024
RA   Mikos M.R., Eller S.R., Iglehart B.S., Leffell M.S.;
RT   ;
RL   Submitted (06-MAR-2007) to the INSDC.
RL   Medicine, Johns Hopkins University, 2041 E. Monument St, Baltimore, MD
RL   21205, USA
XX
DR   MD5; 65481b9567b512d7bd2bb5840881c835.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..2024
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>2024
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*320102"
FT   mRNA            join(<1..61,191..460,702..977,1578..1853,1953..>2024)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*320102"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..61,191..460,702..977,1578..1853,1953..>2024)
FT                   /codon_start=1
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*320102"
FT                   /product="MHC class I antigen"
FT                   /note="major histocompatibility complex; human leukocyte
FT                   antigen A locus"
FT                   /db_xref="IMGT/HLA:A*32:01:02"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:A4URH6"
FT                   /protein_id="ABO86193.1"
FT                   /translation="APRTLLLLLLGALALTQTWAGSHSMRYFFTSVSRPGRGEPRFIAV
FT                   GYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDQETRNVKAHSQTDRESLRIALRY
FT                   YNQSEAGSHTIQMMYGCDVGPDGRLLRGYQQDAYDGKDYIALNEDLRSWTAADMAAQIT
FT                   QRKWEAARVAEQLRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHEATLR
FT                   CWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWASVVVPSGQEQRYTCHV
FT                   QHEGLPKPLTLRWEPSSQPTIPIVGIIAGLVLFGAMF"
FT   exon            <1..61
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*320102"
FT                   /number=1
FT   exon            191..460
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*320102"
FT                   /number=2
FT   exon            702..977
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*320102"
FT                   /number=3
FT   exon            1578..1853
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*320102"
FT                   /number=4
FT   exon            1953..>2024
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*320102"
FT                   /number=5
XX
SQ   Sequence 2024 BP; 374 A; 627 C; 648 G; 375 T; 0 other;
     gcgccccgaa ccctcctcct gctactcttg ggggccctgg ccctgaccca gacctgggcg        60
     ggtgagtgcg gggtcgtggg gaaaccgcct ctgcggggag aagcaagggg cccgcccggc       120
     gggggcgcag gacccgggta gccgcgccgg gaggagggtc gggcgggtct cagccactcc       180
     tcgcccccag gctcccactc catgaggtat ttcttcacat ccgtgtcccg gcccggccgc       240
     ggggagcccc gcttcatcgc cgtgggctac gtggacgaca cgcagttcgt gcggtttgac       300
     agcgacgccg cgagccagag gatggagccg cgggcgccgt ggatagagca ggaggggccg       360
     gagtattggg accaggagac acggaatgtg aaggcccact cacagactga ccgagagagc       420
     ctgcggatcg cgctccgcta ctacaaccag agcgaggccg gtgagtgacc ccggcccggg       480
     gcgcaggtca cgacctctca tcccccacgg acgggccagg tcgcccacag tctccgggtc       540
     cgagatccac cccgaagccg cgggaccccg agacccttgc cccgggagag gcccaggcgc       600
     ctttacccgg tttcattttc agtttaggcc aaaaatcccc ccgggttggt cggggccgga       660
     cggggctcgg gggactgggc tgaccgtggg gtcggggcca ggttctcaca ccatccagat       720
     gatgtatggc tgcgacgtgg ggccggacgg gcgcctcctc cgcgggtacc agcaggacgc       780
     ctacgacggc aaggattaca tcgccttgaa cgaggacctg cgctcttgga ccgcggcgga       840
     catggcggct cagatcaccc agcgcaagtg ggaggcggcc cgtgtggcgg agcagttgag       900
     agcctacctg gagggcacgt gcgtggagtg gctccgcaga tacctggaga acgggaagga       960
     gacgctgcag cgcacgggta ccaggggcca cggggcgcct ccctgatcgc ctgtagatct      1020
     cccgggctgg cctcccacaa ggaggggaga caattgggac caacactaga atatcgccct      1080
     ccctctggtc ctgagggaga ggaatcctcc tgggtttcca gatcctgtac cagagagtga      1140
     ctctgaggtt ccgccctgct ctctgacaca attaagggat aaaatctctg aaggaatgac      1200
     gggaagacga tccctcgaat actgatgagt ggttcccttt gacacacacc ggcagcagcc      1260
     ttgggcccgt gacttttcct ctcaggcctt gttctctgct tcacactcaa tgtgtgtggg      1320
     ggtctgagtc cagcacttct gagtccctca gcctccactc aggtcaggac cagaagtcgc      1380
     tgttccctct tcagggacta gaattttcca cggaatagga gattatccca ggtgcctgtg      1440
     tccaggctgg tgtctgggtt ctgtgctccc ttccccatcc caggtgtcct gtccattctc      1500
     aagatagcca catgtgtgct ggaggagtgt cccatgacag atgcaaaatg cctgaatgtt      1560
     ctgactcttc ctgacagacg cccccaagac gcatatgact caccacgctg tctctgacca      1620
     tgaggccacc ctgaggtgct gggccctgag cttctaccct gcggagatca cactgacctg      1680
     gcagcgggat ggggaggacc agacccagga cacggagctt gtggagacca ggcctgcagg      1740
     ggatggaacc ttccagaagt gggcatctgt ggtggtgcct tctggacagg agcagagata      1800
     cacctgccat gtgcagcatg agggtctgcc caagcccctc accctgagat ggggtaagga      1860
     gggagatggg ggtgtcatgt cttttacgga aagcaggagc ctctctgacc tttagcaggg      1920
     tcagggcccc tcaccttccc ctcttttccc agagccgtct tcccagccca ccatccccat      1980
     cgtgggcatc attgctggcc tagttctctt tggagctatg ttcg                       2024
//