spacer

EBI Dbfetch

ID   EF471359; SV 1; linear; genomic DNA; STD; HUM; 1666 BP.
XX
AC   EF471359;
XX
DT   09-APR-2007 (Rel. 91, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 2)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*0122N allele, exons 2
DE   through 4 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1666
RA   Eller S.R., Iglehart B.S., Leffell M.S.;
RT   ;
RL   Submitted (06-MAR-2007) to the INSDC.
RL   Medicine, Johns Hopkins University, 2041 E. Monument St, Baltimore, MD
RL   21205, USA
XX
DR   MD5; 62a0169264dd0c6f8ea338fb6438a634.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1666
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1666
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0122N"
FT   mRNA            join(<26..295,537..812,1392..>1666)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0122N"
FT                   /product="MHC class I antigen"
FT   CDS             join(<26..295,537..812,1392..1660)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0122N"
FT                   /product="MHC class I antigen"
FT                   /note="major histocompatibility complex; human leukocyte
FT                   antigen A locus; deletion results in premature stop codon"
FT                   /db_xref="GOA:A4URH5"
FT                   /db_xref="IMGT/HLA:A*01:22N"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:A4URH5"
FT                   /protein_id="ABO86192.1"
FT                   /translation="SHSMRYFFTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQKME
FT                   PRAPWIEQEGPEYWDQETRNMKAHSQTDRANLGTLRGYYNQSEDGSHTIQIMYGCDVGP
FT                   DGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAVHAAEQRRVYLEGRC
FT                   VDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGED
FT                   QTHTRSSWRPGLQGMEPSRSGRLWWCLLERSRDTPAMCSMRVCPSPSP"
FT   exon            26..295
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0122N"
FT                   /number=2
FT   exon            537..812
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0122N"
FT                   /number=3
FT   exon            1392..1666
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*0122N"
FT                   /number=4
FT   variation       1521^1522
FT                   /gene="HLA-A"
XX
SQ   Sequence 1666 BP; 321 A; 517 C; 527 G; 301 T; 0 other;
     ggtctcagcc actgctcgcc cccaggctcc cactccatga ggtatttctt cacatccgtg        60
     tcccggcccg gccgcgggga gccccgcttc atcgccgtgg gctacgtgga cgacacgcag       120
     ttcgtgcggt tcgacagcga cgccgcgagc cagaagatgg agccgcgggc gccgtggata       180
     gagcaggagg ggccggagta ttgggaccag gagacacgga atatgaaggc ccactcacag       240
     actgaccgag cgaacctggg gaccctgcgc ggctactaca accagagcga ggacggtgag       300
     tgaccccggc ccggggcgca ggtcacgacc cctcatcccc cacggacggg ccaggtcgcc       360
     cacagtctcc gggtccgaga tccaccccga agccgcggga ctccgagacc cttgtcccgg       420
     gagaggccca ggcgccttta cccggtttca ttttcagttt aggccaaaaa tccccccggg       480
     ttggtcgggg cggggcgggg ctcgggggac tgggctgacc gcggggtcgg ggccaggttc       540
     tcacaccatc cagataatgt atggctgcga cgtggggccg gacgggcgct tcctccgcgg       600
     gtaccggcag gacgcctacg acggcaagga ttacatcgcc ctgaacgagg acctgcgctc       660
     ttggaccgcg gcggacatgg cagctcagat caccaagcgc aagtgggagg cggtccatgc       720
     ggcggagcag cggagagtct acctggaggg ccggtgcgtg gacgggctcc gcagatacct       780
     ggagaacggg aaggagacgc tgcagcgcac gggtaccagg ggccacgggg cgcctccctg       840
     atcgcctata gatctcccgg gctggcctcc cacaaggagg ggagacaatt gggaccaaca       900
     ctagaatatc accctccctc tggtcctgag ggagaggaat cctcctgggt ttccagatcc       960
     tgtaccagag agtgactctg aggttccgcc ctgctctctg acacaattaa gggataaaat      1020
     ctctgaagga gtgacgggaa gacgatccct cgaatactga tgagtggttc cctttgacac      1080
     cggcagcagc cttgggcccg tgacttttcc tctcaggcct tgttctctgc ttcacactca      1140
     atgtgtgtgg gggtctgagt ccagcacttc tgagtctctc agcctccact caggtcagga      1200
     ccagaagtcg ctgttccctt ctcagggaat agaagattat cccaggtgcc tgtgtccagg      1260
     ctggtgtctg ggttctgtgc tctcttcccc atcccgggtg tcctgtccat tctcaagatg      1320
     gccacatgcg tgctggtgga gtgtcccatg acagatgcaa aatgcctgaa ttttctgact      1380
     cttcccgtca gaccccccca agacacatat gacccaccac cccatctctg accatgaggc      1440
     caccctgagg tgctgggccc tgggcttcta ccctgcggag atcacactga cctggcagcg      1500
     ggatggggag gaccagaccc acacacggag ctcgtggaga ccaggcctgc aggggatgga      1560
     accttccaga agtgggcggc tgtggtggtg ccttctggag aggagcagag atacacctgc      1620
     catgtgcagc atgagggtct gcccaagccc ctcaccctga gatggg                     1666
//


spacer
spacer