Dbfetch

ID   EF469770; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   EF469770;
XX
DT   01-APR-2008 (Rel. 95, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 2)
XX
DE   Homo sapiens MHC class I antigen (HLA-C) gene, HLA-Cw*16 variant allele,
DE   exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Faner R., Gil J., Caro P., Campos E., Ambros C., Briega A.,
RA   Pujol-Borrell R., Juan M., Palou E.;
RT   "Identification of a new Cw*16 allele";
RL   Unpublished.
XX
RN   [2]
RP   1-270
RA   Faner R., Gil J., Caro P., Campos E., Ambros C., Briega A.,
RA   Pujol-Borrell R., Juan M., Palou E.;
RT   ;
RL   Submitted (05-MAR-2007) to the INSDC.
RL   LIRAD (Immunology Lab), Banc de Sang i Teixits, Carretera del Canyet, s/n;
RL   Edifici Institut d'Investigacio Germans Trias i Pujol, Badalona 08916,
RL   Spain
XX
DR   MD5; 967aec9e8ba8836980a59e2b062f824c.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*16 variant"
FT   mRNA            <1..>270
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*16 variant"
FT                   /product="MHC class I antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*16 variant"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:B2BD81"
FT                   /db_xref="IMGT/HLA:C*16:01:03"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:B2BD81"
FT                   /protein_id="ABR31792.1"
FT                   /translation="SHSMRYFYTAVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRGE
FT                   PRAPWVEQEGPEYWDRETQKYKRQAQTDRVSLRNLRGYYNQSEA"
FT   exon            1..270
FT                   /gene="HLA-C"
FT                   /allele="HLA-Cw*16 variant"
FT                   /number=2
XX
SQ   Sequence 270 BP; 55 A; 84 C; 97 G; 34 T; 0 other;
     gctcccactc catgaggtat ttctacaccg ccgtgtcccg gcccggccgc ggagagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagtccaag aggggagccg cgggcgccgt gggtggagca ggaggggccg gagtattggg       180
     accgagagac acagaagtac aagcgccagg cacagactga ccgagtgagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg                                        270
//