spacer

EBI Dbfetch

ID   EF465413; SV 1; linear; genomic DNA; STD; HUM; 807 BP.
XX
AC   EF465413;
XX
DT   02-APR-2007 (Rel. 91, Created)
DT   17-APR-2011 (Rel. 108, Last updated, Version 3)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*11 variant allele,
DE   exons 2, 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-807
RX   DOI; 10.1111/j.1744-313X.2008.00827.x.
RX   PUBMED; 19284447.
RA   Chen M.J., Chu C.C., Shyr M.H., Lin P.Y., Yang K.L.;
RT   "Identification of a novel HLA-A allele, A*1131, in a Taiwanese";
RL   Int. J. Immunogenet. 36(2):121-123(2009).
XX
RN   [2]
RP   1-807
RX   DOI; 10.1111/j.1744-313X.2010.00974.x.
RX   PUBMED; 21362146.
RA   Yang K.L., Lee S.K., Lin C.C., Jiang S., Chiu H.M., Lin S., Chen Y.C.,
RA   Jian Y.F., Chen M.J., Shyr M.H., Lin C.L., Lin P.Y.;
RT   "Identification of a novel HLA-A allele, A*11:60, in a Taiwanese family";
RL   Int. J. Immunogenet. 38(2):167-169(2011).
XX
RN   [3]
RP   1-807
RA   Yang K.;
RT   ;
RL   Submitted (01-MAR-2007) to the INSDC.
RL   Dept. of Immunogenetics, Tzu Chi Stem Cells Centre, 707, Section 3, Chung
RL   Yang Road, Hualien 970, Taiwan
XX
DR   MD5; 380a8f7595dd50ad8074d9e44d2e0938.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..807
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>807
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*11 variant"
FT   mRNA            join(<11..280,522..>797)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*11 variant"
FT                   /product="MHC class I antigen"
FT   CDS             join(<11..280,522..>797)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*11 variant"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:A4L9U0"
FT                   /db_xref="IMGT/HLA:A*11:31"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:A4L9U0"
FT                   /protein_id="ABO61519.1"
FT                   /translation="SHSMRYFYTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDQETRNVKAQSQTDRVDLGTLRGYYNQSEDGSHTIQIMYGCDVGP
FT                   DGRFLRGYRQDAYDGKDYIALNEDLRSWTAADMAAQITKRKWEAAHVAEQLRAYLEGRC
FT                   VEWLRRYLENGKETLQRT"
FT   exon            11..280
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*11 variant"
FT                   /number=2
FT   exon            522..797
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*11 variant"
FT                   /number=3
XX
SQ   Sequence 807 BP; 147 A; 256 C; 291 G; 113 T; 0 other;
     tcgcccccag gctcccactc catgaggtat ttctacacct ccgtgtcccg gcccggccgc        60
     ggggagcccc gcttcatcgc cgtgggctac gtggacgaca cgcagttcgt gcggttcgac       120
     agcgacgccg cgagccagag gatggagccg cgggcgccgt ggatagagca ggaggggccg       180
     gagtattggg accaggagac acggaatgtg aaggcccagt cacagactga ccgagtggac       240
     ctggggaccc tgcgcggcta ctacaaccag agcgaggacg gtgagtgacc ccggcccggg       300
     gcgcaggtca cgacccctca tcccccacgg acgggccagg tggcccacag tctccgggtc       360
     cgagatccac cccgaagccg cgggaccccg agacccttgc cccgggagag gcccaggcgc       420
     ctttacccgg tttcattttc agtttaggcc aaaaatcccc ccgggttggt cggggccggg       480
     cagggcttgg gggactgggc tgaccgcggg gtcggggcca ggttctcaca ccatccagat       540
     aatgtatggc tgcgacgtgg ggccggacgg gcgcttcctc cgcgggtacc ggcaggacgc       600
     ctacgacggc aaggattaca tcgccctgaa cgaggacctg cgctcttgga ccgcggcgga       660
     catggcagct cagatcacca agcgcaagtg ggaggcggcc catgtggcgg agcagttgag       720
     agcctacctg gagggccggt gcgtggagtg gctccgcaga tacctggaga acgggaagga       780
     gacgctgcag cgcacgggta ccagggg                                           807
//


spacer
spacer