Dbfetch

ID   EF453695; SV 1; linear; genomic DNA; STD; HUM; 646 BP.
XX
AC   EF453695;
XX
DT   21-MAR-2007 (Rel. 91, Created)
DT   03-NOV-2008 (Rel. 97, Last updated, Version 3)
XX
DE   Homo sapiens MHC class I antigen (HLA-Cw) gene, HLA-Cw*03 new allele, exons
DE   2, 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-646
RX   DOI; 10.1111/j.1399-0039.2008.01117.x.
RX   PUBMED; 18778328.
RA   Cheng L.H., Li Z., Jin S.Z., Zou H.Y.;
RT   "Sequence-based typing characterization of the novel HLA-Cw*0340 allele in
RT   a Chinese individual";
RL   Tissue Antigens 72(5):495-497(2008).
XX
RN   [2]
RP   1-646
RA   Cheng L.-H., Zhu W.-G., Jin S.-Z., Li Z., Zou H.-Y.;
RT   ;
RL   Submitted (25-FEB-2007) to the INSDC.
RL   Shenzhen Institute of Transfusion Medicine, Shenzhen Blood Center, Nigang
RL   Xi Road, Meigang Nan Street, Shenzhen, Guangdong 518035, China
XX
DR   MD5; d9460b3ae2cae900c6bdc37d71c532cc.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..646
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>646
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*03 new"
FT   mRNA            join(<1..270,371..>646)
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*03 new"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,371..>646)
FT                   /codon_start=3
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*03 new"
FT                   /product="MHC class I antigen"
FT                   /db_xref="IMGT/HLA:C*03:40:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:A4GXC4"
FT                   /protein_id="ABO31936.1"
FT                   /translation="SHSMRYFYTAVSRPGRGEPHFIAVGYVDDTQFVRFDSDAASPRGE
FT                   PRAPWVEQEGPEYWDRETQKYKRQAQTDRVSLRNLRGYYNQSEAGSHIIQRMYGCDVGP
FT                   DGRLLRGYDQSAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAREAEQLRAYLEGLC
FT                   VEWLRRYLKNGKETLQRA"
FT   exon            1..270
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*03 new"
FT                   /number=2
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..646
FT                   /gene="HLA-Cw"
FT                   /allele="HLA-Cw*03 new"
FT                   /number=3
FT   variation       382
FT                   /gene="HLA-Cw"
FT                   /replace="c"
FT                   /note="as compared to HLA-Cw*0302"
XX
SQ   Sequence 646 BP; 106 A; 166 C; 200 G; 74 T; 100 other;
     gctcccactc catgaggtat ttctacaccg ctgtgtcccg gcccggccgc ggggagcccc        60
     acttcatcgc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagtccgag aggggagccg cgggcgccgt gggtggagca ggaggggccg gagtattggg       180
     accgggagac acagaagtac aagcgccagg cacagactga ccgagtgagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn ggtctcacat catccagagg atgtatggct gcgacgtggg gcccgacggg       420
     cgcctcctcc gcgggtatga ccagtccgcc tacgacggca aggattacat cgccctgaac       480
     gaggatctgc gctcctggac cgccgcggac acggcggctc agatcaccca gcgcaagtgg       540
     gaggcggccc gtgaggcgga gcagctgaga gcctacctgg agggcctgtg cgtggagtgg       600
     ctccgcagat acctgaagaa tgggaaggag acgctgcagc gcgcgg                      646
//