spacer

EBI Dbfetch

ID   EF450253; SV 1; linear; genomic DNA; STD; HUM; 811 BP.
XX
AC   EF450253;
XX
DT   21-MAR-2007 (Rel. 91, Created)
DT   15-SEP-2010 (Rel. 106, Last updated, Version 2)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*51 variant allele,
DE   exons 2, 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-811
RX   DOI; 10.1111/j.1399-0039.2010.01519.x.
RX   PUBMED; 20545900.
RA   Chu C.C., Lu Y.T., Lai S.K., Lee H.L., Lin M.;
RT   "Identification of the novel allele HLA-B*51:84 by sequence-based typing
RT   method in a Taiwanese individual";
RL   Tissue Antigens 76(4):337-338(2010).
XX
RN   [2]
RP   1-811
RA   Chu C.-C.;
RT   ;
RL   Submitted (21-FEB-2007) to the INSDC.
RL   Medical Research Department, Mackay Memorial Hospital, Taipei, Taiwan
XX
DR   MD5; 56844c077dbc19defbe1ff8f13d7bafe.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..811
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>811
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*51 variant"
FT   mRNA            join(<11..280,526..>801)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*51 variant"
FT                   /product="MHC class I antigen"
FT   CDS             join(<11..280,526..>801)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*51 variant"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:A4GX62"
FT                   /db_xref="IMGT/HLA:B*51:84"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:A4GX62"
FT                   /protein_id="ABO32363.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRTE
FT                   PRAPWIEQEGPEYWDRNTQIFKTNTQTYRENLRIALRYYNQSEAGSHTWQTMYGCDVGP
FT                   DGRLLRGHNQYAYDGKDYIALNEDLSSWTAADTAAQITQGKWEAAREAEQLRAYLEGLC
FT                   VEWLRRHLENGKETLQRA"
FT   exon            11..280
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*51 variant"
FT                   /number=2
FT   exon            526..801
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*51 variant"
FT                   /number=3
XX
SQ   Sequence 811 BP; 148 A; 270 C; 285 G; 108 T; 0 other;
     tcgcccccag gctcccactc catgaggtat ttctacaccg ccatgtcccg gcccggccgc        60
     ggggagcccc gcttcattgc agtgggctac gtggacgaca cccagttcgt gaggttcgac       120
     agcgacgccg cgagtccgag gacggagccc cgggcgccat ggatagagca ggaggggccg       180
     gagtattggg accggaacac acagatcttc aagaccaaca cacagactta ccgagagaac       240
     ctgcggatcg cgctccgcta ctacaaccag agcgaggccg gtgagtgacc ccggcccggg       300
     gcgcaggtca cgactcccca tcccccacgt acggcccggg tcgccccgag tctccgggtc       360
     cgagatccgc ctccctgagg ccgcgggacc cgcccagacc ctcgaccggc gagagcccca       420
     ggcgcgttta cccggtttca ttttcagttg aggccaaaat ccccgcgggt tggtcggggc       480
     ggggcggggc tcgggggacg gtgctgaccg cggggccggg gccagggtct cacacttggc       540
     agacgatgta tggctgcgac gtggggccgg acgggcgcct cctccgcggg cataaccagt       600
     acgcctacga cggcaaagat tacatcgccc tgaacgagga cctgagctcc tggaccgcgg       660
     cggacaccgc ggctcagatc acccagggca agtgggaggc ggcccgtgag gcggagcagc       720
     tgagagccta cctggagggc ctgtgcgtgg agtggctccg cagacacctg gagaacggga       780
     aggagacgct gcagcgcgcg ggtaccaggg g                                      811
//


spacer
spacer