spacer

EBI Dbfetch

ID   EF447434; SV 1; linear; genomic DNA; STD; HUM; 1843 BP.
XX
AC   EF447434;
XX
DT   13-MAR-2007 (Rel. 91, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*40 variant allele,
DE   exons 1 through 4 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1843
RX   DOI; 10.1111/j.1399-0039.2008.01009.x.
RX   PUBMED; 18257897.
RA   Kwon O.J., Kim J., Dirisala V.R., Xiao R., Park C.;
RT   "A new HLA-B*40 variant, B*4073, identified by sequence-based typing in the
RT   Korean population";
RL   Tissue Antigens 71(3):250-251(2008).
XX
RN   [2]
RP   1-1843
RA   Hong S.A., Lee J.S., Kwon O.J.;
RT   ;
RL   Submitted (06-FEB-2007) to the INSDC.
RL   Molecular Genetics, BioSewoom Institute of Bioscience & Biotechnology,
RL   Wooyoung Technocenter 1F, #273-15, Sungsu 2-ga 3-dong, Sungdong-gu, Seoul
RL   133-831, Republic of Korea
XX
DR   MD5; 203bba3a45f643e735a9b0cfae9294cd.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1843
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1843
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40 variant"
FT   mRNA            join(<1..73,203..472,717..992,1568..>1843)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40 variant"
FT                   /product="MHC class I antigen"
FT   CDS             join(1..73,203..472,717..992,1568..>1843)
FT                   /codon_start=1
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40 variant"
FT                   /product="MHC class I antigen"
FT                   /note="HLA-B heavy chain leader peptide, domain 1, 2 and 3"
FT                   /db_xref="GOA:A4GWZ2"
FT                   /db_xref="IMGT/HLA:B*40:73"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:A4GWZ2"
FT                   /protein_id="ABO21860.1"
FT                   /translation="MRVTAPRTVLLLLSAALALTETWAGSHSMRYFHTAMSRPGRGEPR
FT                   FITVGYVDDTLFVRFDSDATSPRKEPRAPWIEQEGPEYWDRETQISKTNTQTYRVSLRN
FT                   LRGYYNQSEAGSHTLQRMYGCDVGPDGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTA
FT                   AQISQRKLEAARVAEQLRAYLEGECVEWLRRYLENGKDKLERADPPKTHVTHHPISDHE
FT                   ATLRCWALGFYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRY
FT                   TCHVQHEGLPKPLTLRW"
FT   exon            <1..73
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40 variant"
FT                   /number=1
FT   gap             74..202
FT                   /estimated_length=129
FT   exon            203..472
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40 variant"
FT                   /number=2
FT   gap             473..716
FT                   /estimated_length=244
FT   exon            717..992
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40 variant"
FT                   /number=3
FT   gap             993..1567
FT                   /estimated_length=575
FT   exon            1568..>1843
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40 variant"
FT                   /number=4
XX
SQ   Sequence 1843 BP; 188 A; 286 C; 294 G; 127 T; 948 other;
     atgcgggtca cggcaccccg aaccgtcctc ctgctgctct cggcggccct ggccctgacc        60
     gagacctggg ccgnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       120
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       180
     nnnnnnnnnn nnnnnnnnnn nngctcccac tccatgaggt atttccacac cgccatgtcc       240
     cggcccggcc gcggggagcc ccgcttcatc accgtgggct acgtggacga cacgctgttc       300
     gtgaggttcg acagcgacgc cacgagtccg aggaaggagc cgcgggcgcc atggatagag       360
     caggaggggc cggagtattg ggaccgggag acacagatct ccaagaccaa cacacagact       420
     taccgagtga gcctgcggaa cctgcgcggc tactacaacc agagcgaggc cgnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       540
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       600
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       660
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnggtc       720
     tcacaccctc cagaggatgt acggctgcga cgtggggccg gacgggcgcc tcctccgcgg       780
     gcataaccag tacgcctacg acggcaagga ttacatcgcc ctgaacgagg acctgcgctc       840
     ctggaccgcc gcggacacgg cggctcagat ctcccagcgc aagttggagg cggcccgtgt       900
     ggcggagcag ctgagagcct acctggaggg cgagtgcgtg gagtggctcc gcagatacct       960
     ggagaacggg aaggacaagc tggagcgcgc tgnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1020
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1080
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1140
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1200
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1260
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1320
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1380
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1440
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1500
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1560
     nnnnnnnacc ccccaaagac acacgtgacc caccacccca tctctgacca tgaggccacc      1620
     ctgaggtgct gggccctggg tttctaccct gcggagatca cactgacctg gcagcgggat      1680
     ggcgaggacc aaactcagga cactgagctt gtggagacca gaccagcagg agatagaacc      1740
     ttccagaagt gggcagctgt ggtggtgcct tctggagaag agcagagata cacatgccat      1800
     gtacagcatg aggggctgcc gaagcccctc accctgagat ggg                        1843
//


spacer
spacer