Dbfetch

ID   EF426474; SV 1; linear; genomic DNA; STD; HUM; 276 BP.
XX
AC   EF426474;
XX
DT   05-MAR-2007 (Rel. 90, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 2)
XX
DE   Homo sapiens MHC class I (HLA-B) gene, HLA-B*3503 allele, partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-276
RA   Mele L., Balza G., Arata M., Cagnati M., Verri M.G.;
RT   "A new HLA B*3503 allele";
RL   Unpublished.
XX
RN   [2]
RP   1-276
RA   Mele L., Balza G., Arata M., Cagnati M., Verri M.G.;
RT   ;
RL   Submitted (07-FEB-2007) to the INSDC.
RL   Haematology and Transfusion Medicine, SS Antonio E Biagio Hospital, Via
RL   Venezia 16, Alessandria, AL 15100, Italy
XX
DR   MD5; 3e15420995784c4b901c92de1d172fc3.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..276
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>276
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*3503"
FT   mRNA            <1..>276
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*3503"
FT                   /product="MHC class I"
FT   CDS             <1..>276
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*3503"
FT                   /product="MHC class I"
FT                   /db_xref="GOA:A3RLM7"
FT                   /db_xref="IMGT/HLA:B*35:75"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:A3RLM7"
FT                   /protein_id="ABO10496.1"
FT                   /translation="SHILQRMYGCDLGPDGRLLRGHDQFAYDGKDYIALNEDLSSWTAA
FT                   DTAAQITQRKWEAARVAEQLRAYLEGLCVEWLRRYLENGKETLQRA"
XX
SQ   Sequence 276 BP; 51 A; 86 C; 101 G; 38 T; 0 other;
     ggtctcacat cctccagagg atgtatggct gcgacctggg gcccgacggg cgcctcctcc        60
     gcgggcatga ccagttcgcc tacgacggca aggattacat cgccctgaac gaggacctga       120
     gctcctggac cgcggcggac accgcggctc agatcaccca gcgcaagtgg gaggcggccc       180
     gtgtggcgga gcagctgaga gcctacctgg agggcctgtg cgtggagtgg ctccgcagat       240
     acctggagaa cgggaaggag acgctgcagc gcgcgg                                 276
//