Dbfetch

ID   EF379939; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   EF379939;
XX
DT   20-FEB-2007 (Rel. 90, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 2)
XX
DE   Homo sapiens MHC class I antigen (HLA) gene, HLA-Cw*150201Nnew allele, exon
DE   2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   He X., Li W., Wang L., Wang Z., Liu N., Ni L., Cui S., Wang L., Zhao B.,
RA   Gong Z., Shan X., Zhang Z.;
RT   "Identification of a Novel HLA-Cw Allele HLA-Cw*150201N in Chinese Bone
RT   Marrow Patients";
RL   Unpublished.
XX
RN   [2]
RP   1-270
RA   He X., Li W., Wang L., Wang Z., Liu N., Ni L., Cui S., Wang L., Zhao B.,
RA   Gong Z., Shan X., Zhang Z.;
RT   ;
RL   Submitted (23-JAN-2007) to the INSDC.
RL   HLA Laboratory, Beijing Red Cross Blood Center, No.37 Beisanhuan Zhonglu,
RL   Beijing 100088, China
XX
DR   MD5; 41563d9284581055b8887e6f7887fdbd.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6q21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA"
FT                   /allele="Cw*150201Nnew"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA"
FT                   /allele="Cw*150201Nnew"
FT                   /product="MHC class I antigen"
FT                   /db_xref="IMGT/HLA:C*15:21"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:A3FJ97"
FT                   /protein_id="ABN55658.1"
FT                   /translation="SHSMRYFYTAVSRPGRGEPHFIAVGYVDDTQFVRFDSDAASPRGE
FT                   PRAPWVEQEGPEYWDRETQNYKRQAQTDRVSLRKLRGYYNQSEA"
FT   exon            1..270
FT                   /gene="HLA"
FT                   /allele="Cw*150201Nnew"
FT                   /number=2
FT   variation       229
FT                   /gene="HLA"
FT                   /replace="a"
FT                   /note="compared to allele Cw*150201N"
XX
SQ   Sequence 270 BP; 56 A; 83 C; 96 G; 35 T; 0 other;
     gctcccactc catgaggtat ttctacaccg ctgtgtcccg gcccggccgc ggagagcccc        60
     acttcatcgc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagtccaag aggggagccg cgggcgccgt gggtggagca ggaggggccg gagtattggg       180
     accgggagac acagaactac aagcgccagg cacagactga ccgagtgagc ctgcggaaac       240
     tgcgcggcta ctacaaccag agcgaggccg                                        270
//