spacer

EBI Dbfetch

ID   EF375691; SV 1; linear; genomic DNA; STD; HUM; 790 BP.
XX
AC   EF375691;
XX
DT   19-FEB-2007 (Rel. 90, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 2)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B-B*380101 variant
DE   allele, exons 2, 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-790
RA   Lazaro A.M., Xiao Y., Cao K., Hurley C.K.;
RT   "Novel HLA class I allele";
RL   Unpublished.
XX
RN   [2]
RP   1-790
RA   Lazaro A.M., Xiao Y., Cao K., Hurley C.K.;
RT   ;
RL   Submitted (22-JAN-2007) to the INSDC.
RL   Oncology, Georgetown University, 3970 Reservoir Rd, N.W., Washington, DC
RL   20057, USA
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..790
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /clone="NT00710-"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>790
FT                   /gene="HLA-B"
FT                   /allele="B*380101 variant"
FT   mRNA            join(<1..270,516..>790)
FT                   /gene="HLA-B"
FT                   /allele="B*380101 variant"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,516..>790)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="B*380101 variant"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:A3FG59"
FT                   /db_xref="IMGT/HLA:B*38:16"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:A3FG59"
FT                   /protein_id="ABN51223.1"
FT                   /translation="SHSMRYFYTSVSRPGRGEPRFITVGYVDDTQFVRFDSDAASPREE
FT                   PRAPWIEQEGPEYWDRNTQICKTNTQTYRENLRIALRYYNQSEAGSHTLQRMYGCDVGP
FT                   DGRLLRGHNQFAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRTYLEGTC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            <1..270
FT                   /gene="HLA-B"
FT                   /allele="B*380101 variant"
FT                   /number=2
FT   gap             271..515
FT                   /estimated_length=245
FT   exon            516..>790
FT                   /gene="HLA-B"
FT                   /allele="B*380101 variant"
FT                   /number=3
XX
SQ   Sequence 790 BP; 114 A; 173 C; 186 G; 72 T; 245 other;
     gctcccactc catgaggtat ttctacacct ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcac cgtgggctac gtggacgaca cgcagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag agaggagccg cgggcgccgt ggatagagca ggaggggccg gaatattggg       180
     accggaacac acagatctgc aagaccaaca cacagactta ccgagagaac ctgcggatcg       240
     cgctccgcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       420
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnggtct cacaccctcc agaggatgta       540
     cggctgcgac gtggggccgg acgggcgcct cctccgcggg cataaccagt tcgcctacga       600
     cggcaaggat tacatcgccc tgaacgagga cctgagctcc tggaccgcgg cggacaccgc       660
     ggctcagatc acccagcgca agtgggaggc ggcccgtgtg gcggagcagc tgagaaccta       720
     cctggagggc acgtgcgtgg agtggctccg cagatacctg gagaacggga aggagacgct       780
     gcagcgcgcg                                                              790
//


spacer
spacer