Dbfetch

ID   EF375550; SV 1; linear; genomic DNA; STD; HUM; 1521 BP.
XX
AC   EF375550;
XX
DT   04-JUL-2007 (Rel. 92, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 2)
XX
DE   Homo sapiens MHC class I antigen (HLA-G) gene, HLA-G*0008 allele, exons 2
DE   through 4 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1521
RX   DOI; 10.1111/j.1399-0039.2007.00862.x.
RX   PUBMED; 17610427.
RA   Moscoso J., Serrano-Vela J.I., Perez-Saborido B., Moreno E.,
RA   Arnaiz-Villena A.;
RT   "A novel HLA-G allele (HLA-G*0108) with an alpha-3 domain amino acid
RT   change";
RL   Tissue Antigens 70(2):171-173(2007).
XX
RN   [2]
RP   1-1521
RA   Arnaiz-Villena A.;
RT   ;
RL   Submitted (22-JAN-2007) to the INSDC.
RL   Immunology, Universidad Complutense de Madrid, Avenida Complutense s/n,
RL   Madrid 28040, Spain
XX
DR   MD5; 9a3336e6e47ff971ada153e85a0ceded.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1521
FT                   /organism="Homo sapiens"
FT                   /isolate="TXH12-D8"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1521
FT                   /gene="HLA-G"
FT                   /allele="HLA-G*0008"
FT   mRNA            join(<1..270,371..646,1246..>1521)
FT                   /gene="HLA-G"
FT                   /allele="HLA-G*0008"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,371..646,1246..>1521)
FT                   /codon_start=3
FT                   /gene="HLA-G"
FT                   /allele="HLA-G*0008"
FT                   /product="MHC class I antigen"
FT                   /db_xref="IMGT/HLA:G*01:08"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:A6YB83"
FT                   /protein_id="ABQ51012.1"
FT                   /translation="SHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPRME
FT                   PRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDLGS
FT                   DGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEGTC
FT                   VEWLHRYLENGKEMLQRADPPKTHVTHHPVFDYEATLRCWALGFYPAEIILTWQWDGED
FT                   QTQDVELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPEPLMLRW"
FT   exon            1..270
FT                   /gene="HLA-G"
FT                   /allele="HLA-G*0008"
FT                   /number=2
FT                   /note="alpha 1 region"
FT   gap             271..370
FT                   /estimated_length=unknown
FT   exon            371..646
FT                   /gene="HLA-G"
FT                   /allele="HLA-G*0008"
FT                   /number=3
FT                   /note="alpha 2 region"
FT   exon            1246..1521
FT                   /gene="HLA-G"
FT                   /allele="HLA-G*0008"
FT                   /number=4
FT                   /note="alpha 3 region"
XX
SQ   Sequence 1521 BP; 290 A; 415 C; 445 G; 271 T; 100 other;
     gctcccactc catgaggtat ttcagcgccg ccgtgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc catgggctac gtggacgaca cgcagttcgt gcggttcgac agcgactcgg       120
     cgtgtccgag gatggagccg cgggcgccgt gggtggagca ggaggggcca gagtattggg       180
     aagaggagac acggaacacc aaggcccacg cacagactga cagaatgaac ctgcagaccc       240
     tgcgcggcta ctacaaccag agcgaggcca nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn gttctcatac cctccagtgg atgattggct gcgacctggg gtccgacgga       420
     cgcctcctcc gcgggtatga acagtatgcc tacgatggca aggattacct cgccctgaac       480
     gaggacctgc gctcctggac cgcagcggac actgcggctc agatctccaa gcgcaagtgt       540
     gaggcggcca atgtggctga acaaaggaga gcctacctgg agggcacgtg cgtggagtgg       600
     ctccacagat acctggagaa cgggaaggag atgctgcagc gcgcgggtac caggggcagt       660
     ggggcgcctc cctgatctcc tgtagacctc ccagcctggc ctagcacaag gagaggagga       720
     aaatgggacc aacaccagaa tatcgccctc cctctggtcc tgagggagag gaatcctcct       780
     gggtttccag atcctgtacc agagagtgat tctgagggcc cgtcctgctc tctgggacaa       840
     ttaagggatg aagtctctga gggagtggag gggaagacaa tccctggagg actgatcagg       900
     ggttcccttt gaccccacag cagccttggc accaggactt ttcccctcag gccttgttct       960
     ctgcctcaca ctcaatgtgt gtgggagtct gactccagct cctctgagtc ccttggcctc      1020
     cactcaggtc agaaccagag gtccctgctc ccccgctcag agactagaac tttccaagga      1080
     ataggagatt atcccaggtg cccgtgtcca ggctggtgtc tgggttctgt gctcccttcc      1140
     ccaccccagg tatctggttc attcttagga tggtcacatc caggtgctgc tggagtgtcc      1200
     catgagagat gcaaagtgct tgagttttct gactcttcct ttcagacccc cccaagacac      1260
     acgtgaccca ccaccctgtc tttgactatg aggccaccct gaggtgctgg gccctgggct      1320
     tctaccctgc ggagatcata ctgacctggc agtgggatgg ggaggaccag acccaggacg      1380
     tggagctcgt ggagaccagg cctgcagggg atggaacctt ccagaagtgg gcagctgtgg      1440
     tggtgccttc tggagaggag cagagataca cgtgccatgt gcagcatgag gggctgccgg      1500
     agcccctcat gctgagatgg a                                                1521
//