spacer

EBI Dbfetch

ID   EF363033; SV 1; linear; genomic DNA; STD; HUM; 919 BP.
XX
AC   EF363033;
XX
DT   14-FEB-2007 (Rel. 90, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*40new allele, exons 2,
DE   3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-919
RX   DOI; 10.1111/j.1399-0039.2007.00861.x.
RX   PUBMED; 17610425.
RA   Park J., Kwon O., Hong S., Kwon S., Cho N.;
RT   "Identification of a novel HLA-B*40 allele, HLA-B*4071, by sequence-based
RT   typing";
RL   Tissue Antigens 70(2):170-171(2007).
XX
RN   [2]
RP   1-919
RA   Park J., Kim K., Hong S.-A., Kwon O.-J.;
RT   ;
RL   Submitted (15-JAN-2007) to the INSDC.
RL   Third Research Team, Blood Transfusion Research Institute, Pyong-Dong,
RL   Jongro-Gu, Seoul 110-747, South Korea
XX
DR   MD5; 23f9d940474a6b4dac65ae226923c708.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..919
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>919
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40new"
FT   mRNA            join(<71..340,585..>860)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40new"
FT                   /product="MHC class I antigen"
FT   CDS             join(<71..340,585..>860)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40new"
FT                   /product="MHC class I antigen"
FT                   /note="domain 1 and domain 2"
FT                   /db_xref="GOA:A3F967"
FT                   /db_xref="IMGT/HLA:B*40:71"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:A3F967"
FT                   /protein_id="ABN15022.1"
FT                   /translation="SHSMRYFHTSVSRPGRGEPRFITVGYVDDTLFVRFDSDATSPRKE
FT                   PRAPWIEQEGPEYWDRETQISKTNTQTYRESLRNLRGYYNQSEAGSHTLQSMYGCDVGP
FT                   DGRLLRGHNQLAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGLC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            71..340
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40new"
FT                   /number=2
FT   exon            585..860
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40new"
FT                   /number=3
XX
SQ   Sequence 919 BP; 157 A; 309 C; 335 G; 118 T; 0 other;
     gggggcgcag gacccgggga gccgcgccgg gaggagggtc gggcgggtct cagcccctcc        60
     tcgcccccag gctcccactc catgaggtat ttccacacct ccgtgtcccg gcccggccgc       120
     ggggagcccc gcttcatcac cgtgggctac gtggacgaca cgctgttcgt gaggttcgac       180
     agcgacgcca cgagtccgag gaaggagccg cgggcgccat ggatagagca ggaggggccg       240
     gagtattggg accgggagac acagatctcc aagaccaaca cacagactta ccgagagagc       300
     ctgcggaacc tgcgcggcta ctacaaccag agcgaggccg gtgagtgacc ccggcccggg       360
     gcgcaggtca cgactcccca tcccccacgt acggcccggg tcgccccgag tctccgggtc       420
     cgagatccgc ccccgaggcc gcgggacccg cccagaccct cgaccggcga gagccccagg       480
     cgcgtttacc cggtttcatt ttcagttgag gccaaaatcc ccgcgggttg gtcggggcgg       540
     ggcggggctc ggggggacgg ggctgaccgc gggggcgggg ccagggtctc acaccctcca       600
     gagcatgtac ggctgcgacg tggggccgga cgggcgcctc ctccgcgggc ataaccagtt       660
     agcctacgac ggcaaggatt acatcgccct gaacgaggac ctgagctcct ggaccgcggc       720
     ggacaccgcg gctcagatca cccagcgcaa gtgggaggcg gcccgtgtgg cggagcagct       780
     gagagcctac ctggagggcc tgtgcgtgga gtggctccgc agatacctgg agaacgggaa       840
     ggagacgctg cagcgcgcgg gtaccagggg cagtggggag ccttccccat ctcctatagg       900
     tcgccgggga tggcctccc                                                    919
//


spacer
spacer