spacer

EBI Dbfetch

ID   EF362805; SV 2; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   EF362805;
XX
DT   14-FEB-2007 (Rel. 90, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1*0701 variant
DE   allele, exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Cormack C.E.P., Davey S., Brown C.J.;
RT   "MHC Class II Antigen (HLA-DRB1) Gene HLA-DRB1*0701 variant allele, exon
RT   2";
RL   Unpublished.
XX
RN   [2]
RP   1-270
RA   Cormack C.E.P., Davey S., Brown C.J.;
RT   ;
RL   Submitted (15-JAN-2007) to the INSDC.
RL   Histocompatibility & Immunogenetics, NHS Blood and Transplant, Colindale
RL   Avenue, Colindale, London NW9 5BG, United Kingdom
XX
RN   [3]
RC   Sequence update by submitter
RP   1-270
RA   Cormack C.E.P., Davey S., Brown C.J.;
RT   ;
RL   Submitted (06-APR-2007) to the INSDC.
RL   Histocompatibility & Immunogenetics, NHS Blood and Transplant, Colindale
RL   Avenue, Colindale, London NW9 5BG, United Kingdom
XX
DR   MD5; 2f902b613e1dde9c88b5b7759ede9ec9.
XX
CC   On Apr 6, 2007 this sequence version replaced gi:125492041.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*0701 variant"
FT   mRNA            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*0701 variant"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*0701 variant"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:A3F923"
FT                   /db_xref="IMGT/HLA:DRB1*07:13"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:A3F923"
FT                   /protein_id="ABN43424.1"
FT                   /translation="RFLWQGKYKCHFFNGTERVQFLERLFYNQEEFVRFDSDVGEYRAV
FT                   TELGLPVAESWNSQKDILEDRRGQVDTVCRHNYGVGESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*0701 variant"
FT                   /number=2
XX
SQ   Sequence 270 BP; 58 A; 63 C; 99 G; 50 T; 0 other;
     cacgtttcct gtggcagggt aagtataagt gtcatttctt caacgggacg gagcgggtgc        60
     agttcctgga aagactcttc tataaccagg aggagttcgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctagggc tgcctgtcgc cgagtcctgg aacagccaga       180
     aggacatcct ggaggacagg cggggccagg tggacaccgt gtgcagacac aactacgggg       240
     ttggtgagag cttcacagtg cagcggcgag                                        270
//


spacer
spacer