spacer

EBI Dbfetch

ID   EF218654; SV 1; linear; genomic DNA; STD; HUM; 806 BP.
XX
AC   EF218654;
XX
DT   01-FEB-2008 (Rel. 94, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens isolate JKKB-87 MHC class Ib antigen (HLA-G) gene, exons 2, 3
DE   and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-806
RX   DOI; 10.1111/j.1399-0039.2008.01022.x.
RX   PUBMED; 18346034.
RA   Kang H., Yun H.S., Lee J.K., Kwack K.;
RT   "Identification of a novel HLA-G allele, HLA-G*010113, in a Korean
RT   individual";
RL   Tissue Antigens 71(5):492-494(2008).
XX
RN   [2]
RP   1-806
RA   Moon S.-M., Yun H.-S., Oh B., Kwack K., Lee J.-K.;
RT   "Novel HLA-G allele from Korean";
RL   Unpublished.
XX
RN   [3]
RP   1-806
RA   Moon S.-M., Yun H.-S., Oh B., Kwack K., Lee J.-K.;
RT   ;
RL   Submitted (09-JAN-2007) to the INSDC.
RL   CHA Research Institute, Pochon CHA University, 222 Yatap-dong Bundang-gu,
RL   Seongnam, Gyeongi 463-836, South Korea
XX
DR   MD5; c8fe7330bd5d6423f03405cd4590d281.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..806
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3-p21.1"
FT                   /isolate="JKKB-87"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>779
FT                   /gene="HLA-G"
FT   mRNA            join(<1..276,504..>779)
FT                   /gene="HLA-G"
FT                   /product="MHC class Ib antigen"
FT   CDS             join(<1..276,504..>779)
FT                   /codon_start=3
FT                   /gene="HLA-G"
FT                   /product="MHC class Ib antigen"
FT                   /db_xref="GOA:B0L3P9"
FT                   /db_xref="IMGT/HLA:G*01:01:13"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:B0L3P9"
FT                   /protein_id="ABQ12154.1"
FT                   /translation="PGSHSMRYFSAAVSRPGRGEPRFIAMGYVDDTQFVRFDSDSACPR
FT                   MEPRAPWVEQEGPEYWEEETRNTKAHAQTDRMNLQTLRGYYNQSEASSHTLQWMIGCDL
FT                   GSDGRLLRGYEQYAYDGKDYLALNEDLRSWTAADTAAQISKRKCEAANVAEQRRAYLEG
FT                   TCVEWLHRYLENGKEMLQRA"
FT   exon            <1..276
FT                   /gene="HLA-G"
FT                   /number=2
FT   gap             305..500
FT                   /estimated_length=196
FT   exon            504..>779
FT                   /gene="HLA-G"
FT                   /number=3
XX
SQ   Sequence 806 BP; 126 A; 185 C; 210 G; 89 T; 196 other;
     ccccaggctc ccactccatg aggtatttca gcgccgccgt gtcccggccc ggccgcgggg        60
     agccccgctt catcgccatg ggctacgtgg acgacacgca gttcgtgcgg ttcgacagcg       120
     actcggcgtg tccgaggatg gagccgcggg cgccgtgggt ggagcaggag gggccagagt       180
     attgggaaga ggagacacgg aacaccaagg cccacgcaca gactgacaga atgaacctgc       240
     agaccctgcg cggctactac aaccagagcg aggccagtga gtaaccccgg cccagggcgc       300
     agatnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       420
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn caggttctca taccctccag tggatgattg gctgcgacct       540
     ggggtccgac ggacgcctcc tccgcgggta tgaacagtat gcctacgatg gcaaggatta       600
     cctcgccctg aacgaggacc tgcgctcctg gaccgcagcg gacactgcgg ctcagatctc       660
     caagcgcaag tgtgaggcgg ccaatgtggc tgaacaaagg agagcctacc tggagggcac       720
     gtgcgtggag tggctccata gatacctgga gaacgggaag gagatgctgc agcgcgcggg       780
     taccaggggc agtggggcgc ctccct                                            806
//


spacer
spacer