Dbfetch

ID   EF215531; SV 1; linear; genomic DNA; STD; HUM; 1872 BP.
XX
AC   EF215531;
XX
DT   14-FEB-2007 (Rel. 90, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*9527 allele, exons 2
DE   through 5 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1872
RA   Sikorski P.M., Eller S.R., Iglehart B.S., Leffell M.S.;
RT   ;
RL   Submitted (10-JAN-2007) to the INSDC.
RL   Medicine, Johns Hopkins University, 2041 E. Monument St, Baltimore, MD
RL   21205, USA
XX
DR   MD5; b8fcb32b8ad03def0f77f0b3893f937d.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1872
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1872
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*9527"
FT   mRNA            join(<69..338,584..859,1435..1710,1815..>1872)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*9527"
FT                   /product="MHC class I antigen"
FT   CDS             join(<69..338,584..859,1435..1710,1815..>1872)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*9527"
FT                   /product="MHC class I antigen"
FT                   /note="major histocompatibility complex; human leukocyte
FT                   antigen B"
FT                   /db_xref="IMGT/HLA:B*15:127"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="UniProtKB/TrEMBL:A3F720"
FT                   /protein_id="ABN11363.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREE
FT                   PRAPWIEQEGPEYWDRETQISKTNTQTYRESLRNLRGYYNQSEAGSHTLQRMYGCDVGP
FT                   DGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAAREAEQLRAYLAGLC
FT                   VEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAEITLTWQRDGED
FT                   QTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEPSSQSTI
FT                   PIVGIVAGLAVL"
FT   exon            69..338
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*9527"
FT                   /number=2
FT   exon            584..859
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*9527"
FT                   /number=3
FT   exon            1435..1710
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*9527"
FT                   /number=4
FT   exon            1815..>1872
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*9527"
FT                   /number=5
XX
SQ   Sequence 1872 BP; 354 A; 587 C; 595 G; 336 T; 0 other;
     tggcgcagga cccggggagc cgcgccggga ggagggtcgg gcgggtctca gcccctcctc        60
     gcccccaggc tcccactcca tgaggtattt ctacaccgcc atgtcccggc ccggccgcgg       120
     ggagccccgc ttcatctcag tgggctacgt ggacgacacg cagttcgtga ggttcgacag       180
     cgacgccgcg agtccgagag aggagccgcg ggcgccgtgg atagagcagg aggggccgga       240
     gtattgggac cgggagacac agatctccaa gaccaacaca cagacttacc gagagagcct       300
     gcggaacctg cgcggctact acaaccagag cgaggccggt gagtgacccc ggcctggggc       360
     gcaggtcacg actccccatc ccccacgtac ggcccgggtc gccccgagtc tccgggtccg       420
     agatccgccc ccctgaggcc gcgggacccg cccaaaccct cgaccggcga gagccccagg       480
     cgcgtttacc cggtttcatt ttcagttgag gccaaaatcc ccgcgggttg gtcggggcgg       540
     ggcggggctc gggggacggg gctgaccgcg gggcctgggc cagggtctca caccctccag       600
     aggatgtacg gctgcgacgt ggggccggac gggcgcctcc tccgcgggca tgaccagtcc       660
     gcctacgacg gcaaggatta catcgccctg aacgaggacc tgagctcctg gaccgcggcg       720
     gacacggcgg ctcagatcac ccagcgcaag tgggaggcgg cccgtgaggc ggagcagctg       780
     agagcctacc tggcgggcct gtgcgtggag tggctccgca gatacctgga gaacgggaag       840
     gagacgctgc agcgcgcggg taccaggggc agtggggagc cttccccatc tcctataggt       900
     cgccggggat ggcctcccac gagaagagga ggaaaatggg atcagcgcta gaatgtcgcc       960
     ctcccttgaa tggagaatgg catgagtttt cctgagtttc ctctgagggc cccctcttct      1020
     ctctaggaca attaagggat gacgtctctg aggaaatgga ggggaagaca gtccctagga      1080
     tagtgatcag gggtcccctt tgacccctgc agcagccttg ggaaccgtga cttttcctct      1140
     caggccttgt tctctgcctc acactcagtg tgtttggggc tctgattcca gcacttctga      1200
     gtcactttac ctccactcag atcaggagca gaagtccctg ttccccgctc agagactcga      1260
     actttccaat gaataggaga ttatcccagg tgcctgcgtc caggctggtg tctgggttct      1320
     gtgccccttc cctaccccag gtgtcctgtc cattctcagg ctggtcacat gggtggtcct      1380
     agggtgtccc atgagagatg caaagcgcct gaattttctg actcttccca tcagaccccc      1440
     caaagacaca tgtgacccac caccccatct ctgaccatga ggccaccctg aggtgctggg      1500
     ccctgggctt ctaccctgcg gagatcacac tgacctggca gcgggatggc gaggaccaaa      1560
     ctcaggacac cgagcttgtg gagaccagac cagcaggaga tagaaccttc cagaagtggg      1620
     cagctgtggt ggtgccttct ggagaagagc agagatacac atgccatgta cagcatgagg      1680
     ggctgccgaa gcccctcacc ctgagatggg gtaaggaggg ggatgagggg tcatatctgt      1740
     tctcagggaa agcaggagcc cttctggagc ccttcagcag ggtcagggcc cctcatcttc      1800
     ccctcctttc ccagagccat cttcccagtc caccatcccc atcgtgggca ttgttgctgg      1860
     cctggctgtc ct                                                          1872
//