spacer

EBI Dbfetch

ID   EF215530; SV 1; linear; genomic DNA; STD; HUM; 1930 BP.
XX
AC   EF215530;
XX
DT   14-FEB-2007 (Rel. 90, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*440303 allele, exons 1
DE   through 5 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1930
RA   Grantland J.N., Eller S.R., Iglehart B.S., Leffell M.S.;
RT   ;
RL   Submitted (10-JAN-2007) to the INSDC.
RL   Medicine, Johns Hopkins University, 2041 E. Monument St, Baltimore, MD
RL   21205, USA
XX
DR   MD5; 3061fffe68e2149a251a52f1080f66c7.
DR   Ensembl-Gn; ENSG00000224608; homo_sapiens.
DR   Ensembl-Tr; ENST00000435618; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1930
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1930
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*440303"
FT   mRNA            join(<1..32,162..431,675..950,1526..1801,1895..>1930)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*440303"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..32,162..431,675..950,1526..1801,1895..>1930)
FT                   /codon_start=2
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*440303"
FT                   /product="MHC class I antigen"
FT                   /note="major histocompatibility complex; human leukocyte
FT                   antigen B"
FT                   /db_xref="GOA:A3F719"
FT                   /db_xref="IMGT/HLA:B*44:03:03"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:A3F719"
FT                   /protein_id="ABN11362.1"
FT                   /translation="GAVALTETWAGSHSMRYFYTAMSRPGRGEPRFITVGYVDDTLFVR
FT                   FDSDATSPRKEPRAPWIEQEGPEYWDRETQISKTNTQTYRENLRTALRYYNQSEAGSHI
FT                   IQRMYGCDVGPDGRLLRGYDQDAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVA
FT                   EQLRAYLEGLCVESLRRYLENGKETLQRADPPKTHVTHHPISDHEVTLRCWALGFYPAE
FT                   ITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLT
FT                   LRWEPSSQSTVPIVG"
FT   exon            <1..32
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*440303"
FT                   /number=1
FT   exon            162..431
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*440303"
FT                   /number=2
FT   exon            675..950
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*440303"
FT                   /number=3
FT   exon            1526..1801
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*440303"
FT                   /number=4
FT   exon            1895..>1930
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*440303"
FT                   /number=5
XX
SQ   Sequence 1930 BP; 369 A; 599 C; 630 G; 332 T; 0 other;
     gggggcagtg gccctgaccg agacctgggc cggtgagtgc ggggtcggga gggaaatggc        60
     ctctgtgggg aggagagagg ggaccgcagg cgggggcgca ggacccgggg agccgcgccg       120
     ggaggagggt cgggcgggtc tcagcccctc ctcgccccca ggctcccact ccatgaggta       180
     tttctacacc gccatgtccc ggcccggccg cggggagccc cgcttcatca ccgtgggcta       240
     cgtggacgac acgctgttcg tgaggttcga cagcgacgcc acgagtccga ggaaggagcc       300
     gcgggcgcca tggatagagc aggaggggcc ggagtattgg gaccgggaga cacagatctc       360
     caagaccaac acacagactt accgagagaa cctgcgcacc gcgctccgct actacaacca       420
     gagcgaggcc ggtgagtgac cccggcccgg ggcgcaggtc acgactcccc atcccccacg       480
     tacggcccgg gtcgccccga gtctccgggt ccgagatccg cccccgaggc cgcgggaccc       540
     gcccagaccc tcgaccggcg agagccccag gcgcgtttac ccggtttcat tttcagttga       600
     ggccaaaatc cccgcgggtt ggtcggggcg gggcggggct cgggggacgg ggctgaccgc       660
     ggggccgggg ccagggtctc acatcatcca gaggatgtac ggctgcgacg tggggccgga       720
     cgggcgcctc ctccgcgggt atgaccagga cgcctacgac ggcaaggatt acatcgccct       780
     gaacgaggac ctgagctcct ggaccgcggc ggacaccgcg gctcagatca cccagcgcaa       840
     gtgggaggcg gcccgtgtgg cggagcagct gagagcctac ctggagggcc tgtgcgtgga       900
     gtcgctccgc agatacctgg agaacgggaa ggagacgctg cagcgcgcgg gtaccagggg       960
     cagtggggag ccttccccat ctcctatagg tcgccgggga tggcctccca cgagaagagg      1020
     aggaaaatgg gatcagcgct agaatgtcgc cctcccttga atggagaatg gcatgagttt      1080
     tcctgagttt cctctgaggg ccccctcttc tctctaggac aattaaggga tgacgtctct      1140
     gaggaaatgg aggggaagac agtccctaga atactgatca ggggtcccct ttgacccctg      1200
     cagcagcctt gggaaccgtg acttttcctc tcaggccttg ttctctgcct cacactcagt      1260
     gtgtttgggg ctctgattcc agcacttctg agtcacttta cctccactca gatcaggagc      1320
     agaagtccct gttccccgct cagagactcg aactttccaa tgaataggag attatcccag      1380
     gtgcctgcgt ccaggctggt gtctgggttc tgtgcccctt ccccacccca ggtgtcctgt      1440
     ccattctcag gctggtcaca tgggtggtcc tagggtgtcc catgagagat gcaaagcgcc      1500
     tgaattttct gactcttccc atcagacccc ccaaagacac atgtgaccca ccaccccatc      1560
     tctgaccatg aggtcaccct gaggtgctgg gccctgggct tctaccctgc ggagatcaca      1620
     ctgacctggc agcgggatgg cgaggaccaa actcaggaca ccgagcttgt ggagaccaga      1680
     ccagcaggag atagaacctt ccagaagtgg gcagctgtgg tggtgccctc tggagaagag      1740
     cagagataca catgccatgt acagcatgag gggctgccga agcccctcac cctgagatgg      1800
     ggtaaggagg gggatgaggg gtcatatctc ttctcaggga aagcaggagc ccttcagcag      1860
     ggtcagggcc cctcatcttc ccttcctttc ccagagccgt cttcccagtc caccgtcccc      1920
     atcgtgggca                                                             1930
//


spacer
spacer