spacer

EBI Dbfetch

ID   EF215529; SV 1; linear; genomic DNA; STD; HUM; 1931 BP.
XX
AC   EF215529;
XX
DT   14-FEB-2007 (Rel. 90, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*270510 allele, exons 1
DE   through 5 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1931
RA   Shomper A.L., Eller S.R., Iglehart B.S., Leffell M.S.;
RT   ;
RL   Submitted (10-JAN-2007) to the INSDC.
RL   Medicine, Johns Hopkins University, 2041 E. Monument St, Baltimore, MD
RL   21205, USA
XX
DR   MD5; 7b380427a5d76d3f45656bbe824aac4a.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1931
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1931
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*270510"
FT   mRNA            join(<1..32,162..431,676..951,1527..1802,1896..>1931)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*270510"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..32,162..431,676..951,1527..1802,1896..>1931)
FT                   /codon_start=2
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*270510"
FT                   /product="MHC class I antigen"
FT                   /note="major histocompatibility complex; human leukocyte
FT                   antigen B"
FT                   /db_xref="GOA:A3F718"
FT                   /db_xref="IMGT/HLA:B*27:05:10"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:A3F718"
FT                   /protein_id="ABN11361.1"
FT                   /translation="GAVALTETWAGSHSMRYFHTSVSRPGRGEPRFITVGYVDDTLFVR
FT                   FDSDAASPREEPRAPWIEQEGPEYWDRETQICKAKAQTDREDLRTLLRYYNQSEAGSHT
FT                   LQNMYGCDVGPDGRLLRGYHQDAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVA
FT                   EQLRAYLEGECVEWLRRYLENGKETLQRADPPKTHVTHHPISDHEATLRCWALGFYPAE
FT                   ITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLT
FT                   LRWEPSSQSTVPIVG"
FT   exon            <1..32
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*270510"
FT                   /number=1
FT   exon            162..431
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*270510"
FT                   /number=2
FT   exon            676..951
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*270510"
FT                   /number=3
FT   exon            1527..1802
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*270510"
FT                   /number=4
FT   exon            1896..>1931
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*270510"
FT                   /number=5
XX
SQ   Sequence 1931 BP; 364 A; 598 C; 637 G; 332 T; 0 other;
     gggggcagtg gccctgaccg agacctgggc tggtgagtgc ggggtcggca gggaaatggc        60
     ctctgtgggg aggagcgagg ggaccgcagg cgggggcgca ggacccgggg agccgcgccg       120
     ggaggagggt cgggcgggtc tcagcccctc ctcgccccca ggctcccact ccatgaggta       180
     tttccacacc tccgtgtccc ggcccggccg cggggagccc cgcttcatca ccgtgggcta       240
     cgtggacgac acgctgttcg tgaggttcga cagcgacgcc gcgagtccga gagaggagcc       300
     gcgggcaccg tggatagagc aggaggggcc ggagtattgg gaccgggaga cacagatctg       360
     caaggccaag gcacagactg accgagagga cctgcggacc ctgctccgct actacaacca       420
     gagcgaggcc ggtgagtgac cccggcccgg ggcgcaggtc acgactcccc atcccccacg       480
     tacggcccgg gtcgccccga gtctccgggt ccgagatccg cccccgaggc cgcgggaccc       540
     gcccagaccc tcgaccggcg agagccccag gcgcgtttac ccggtttcat tttcagttga       600
     ggccaaaatc cccgcgggtt ggtcggggcg gggcggggct cggggggacg gggctgaccg       660
     cgggggcggg gccagggtct cacaccctcc agaatatgta tggctgcgac gtggggccgg       720
     acgggcgcct cctccgcggg taccaccagg acgcctacga cggcaaggat tacatcgccc       780
     tgaacgagga cctgagctcc tggaccgccg cggacacggc ggctcagatc acccagcgca       840
     agtgggaggc ggcccgtgtg gcggagcagc tgagagccta cctggagggc gagtgcgtgg       900
     agtggctccg cagatacctg gagaacggga aggagacgct gcagcgcgcg ggtaccaggg       960
     gcagtgggga gccttcccca tctcctatag gtcgccgggg atggcctccc acgagaagag      1020
     gaggaaaatg ggatcagcgc tagaatgtcg ccctcccttg aatggagaat ggcatgagtt      1080
     ttcctgagtt tcctctgagg gccccctctt ctctctagga caattaaggg atgacgtctc      1140
     tgaggaaatg gaggggaaga cagtccctag aatactgatc aggggtcccc tttgacccct      1200
     gcagcagcct tgggaaccgt gacttttcct ctcaggcctt gttctctgcc tcacactcag      1260
     tgtgtttggg gctctgattc cagcacttct gagtcacttt acctccactc agatcaggag      1320
     cagaagtccc tgttccccgc tcagagactc gaactttcca atgaatagga gattatccca      1380
     ggtgcctgcg tccaggctgg tgtctgggtt ctgtgcccct tccccacccc aggtgtcctg      1440
     tccattctca ggctggtcac atgggtggtc ctagggtgtc ccatgagaga tgcaaagcgc      1500
     ctgaattttc tgactcttcc catcagaccc cccaaagaca cacgtgaccc accaccccat      1560
     ctctgaccat gaggccaccc tgaggtgctg ggccctgggc ttctaccctg cggagatcac      1620
     actgacctgg cagcgggatg gcgaggacca aactcaggac actgagcttg tggagaccag      1680
     accagcagga gatagaacct tccagaagtg ggcagctgtg gtggtgcctt ctggagaaga      1740
     gcagagatac acatgccatg tacagcatga ggggctgccg aagcccctca ccctgagatg      1800
     gggtaaggag ggggatgagg ggtcatatct cttctcaggg aaagcaggag cccttcagca      1860
     gggtcagggc ccctcatctt cccttccttt cccagagccg tcttcccagt ccaccgtccc      1920
     catcgtgggc a                                                           1931
//


spacer
spacer