Dbfetch

ID   EF203080; SV 1; linear; genomic DNA; STD; HUM; 1039 BP.
XX
AC   EF203080;
XX
DT   03-NOV-2008 (Rel. 97, Created)
DT   03-NOV-2008 (Rel. 97, Last updated, Version 1)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*5601 allele, exons 1
DE   through 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1039
RA   Martinez-Laso J., Cervera I., Roman A., Head J., Rodriguez M.;
RT   "Generation of the HLA-B*1516/1517 group of alleles";
RL   Unpublished.
XX
RN   [2]
RP   1-1039
RA   Martinez-Laso J., Cervera I., Roman A., Head J., Rodriguez M.;
RT   ;
RL   Submitted (02-JAN-2007) to the INSDC.
RL   Inmunoterapia Celular, Instituto De Salud Carlos III, CRTA.
RL   Majadahonda-Pozuelo Km. 2,2, Madrid 28220, Spain
XX
DR   MD5; 41cd9cfad3be0f779993935d201e4e9b.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1039
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21"
FT                   /isolate="CU-45B"
FT                   /mol_type="genomic DNA"
FT                   /cell_type="mononuclear cells"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>981
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5601"
FT   mRNA            join(<1..62,191..460,706..>981)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5601"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..62,191..460,706..>981)
FT                   /codon_start=2
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5601"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:B6RC64"
FT                   /db_xref="IMGT/HLA:B*56:01:01:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:B6RC64"
FT                   /protein_id="ABQ09226.1"
FT                   /translation="APRTLLLLLWGALALTETWAGSHSMRYFYTAMSRPGRGEPRFIAV
FT                   GYVDDTQFVRFDSDAASPREEPRAPWIEQEGPEYWDRNTQIYKAQAQTDRESLRNLRGY
FT                   YNQSEAGSHTWQTMYGCDLGPDGRLLRGHNQLAYDGKDYIALNEDLSSWTAADTAAQIT
FT                   QRKWEAARVAEQLRAYLEGLCVEWLRRYLENGKETLQRA"
FT   exon            <1..62
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5601"
FT                   /number=1
FT   exon            191..460
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5601"
FT                   /number=2
FT   exon            706..981
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5601"
FT                   /number=3
XX
SQ   Sequence 1039 BP; 172 A; 341 C; 389 G; 137 T; 0 other;
     ggcaccccga accctcctcc tgctgctctg gggggccctg gccctgaccg agacctgggc        60
     cggtgagtgc gggtcgggag ggaaatggcc tctgtgggga ggagcgaggg gaccgcaggc       120
     gggggcgcag gacccgggga gccgcgccgg gaggagggtc tggcgggtct cagcccctcc       180
     tcgcccccag gctcccactc catgaggtat ttctacaccg ccatgtcccg gcccggccgc       240
     ggggagcccc gcttcatcgc agtgggctac gtggacgaca cgcagttcgt gaggttcgac       300
     agcgacgccg cgagtccgag agaggagccg cgggcgccgt ggatagagca ggaggggccg       360
     gagtattggg accggaacac acagatctac aaggcccagg cacagactga ccgagagagc       420
     ctgcggaacc tgcgcggcta ctacaaccag agcgaggccg gtgagtgacc ccggcccggg       480
     gcgcaggtca cgactcccca tcccccacgt acggcccggg tcgccccgag tctccgggtc       540
     cgagatccgc ctccctgagg ccgcgggacc cgcccagacc ctcgaccggc gagagcccca       600
     ggcgcgttta cccggtttca ttttcagttg aggccaaaat ccccgcgggt tggtcggggc       660
     ggggcggggc tcgggggacg gggctgaccg cggggccggg gccagggtct cacacttggc       720
     agacgatgta tggctgcgac ctggggccgg acgggcgcct cctccgcggg cataaccagt       780
     tagcctacga cggcaaggat tacatcgccc tgaacgagga cctgagctcc tggaccgcgg       840
     cggacaccgc ggctcagatc acccagcgca agtgggaggc ggcccgtgtg gcggagcagc       900
     tgagagccta cctggagggc ctgtgcgtgg agtggctccg cagatacctg gagaacggga       960
     aggagacgct gcagcgcgcg ggtaccaggg gcagtgggga gccttcccca tctcctatag      1020
     gtcgccgggg atggcctcc                                                   1039
//