spacer

EBI Dbfetch

ID   EF200124; SV 1; linear; genomic DNA; STD; HUM; 800 BP.
XX
AC   EF200124;
XX
DT   29-JAN-2007 (Rel. 90, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*2314var allele, exons
DE   2, 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-800
RX   DOI; 10.1111/j.1399-0039.2007.00835.x.
RX   PUBMED; 17498272.
RA   Abdeen H., McErlean C., Moraes M.E., Torres M., Campiotto S., Galvao S.,
RA   Gouvea C., Middleton D.;
RT   "Identification of three novel alleles of HLA-DRB1 and HLA-A in the
RT   Brazilian population";
RL   Tissue Antigens 69(6):607-610(2007).
XX
RN   [2]
RP   1-800
RA   Abdeen H., McErlean C., Moraes M.E., Middleton D.;
RT   ;
RL   Submitted (28-DEC-2006) to the INSDC.
RL   Northern Ireland Histocompatibility and Immunogenetics, Belfast City
RL   Hospital, Lisburn Road, Belfast BT9 7TS, UK
XX
DR   MD5; c05f35a631f6cc422f7d86ff0e1e1730.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..800
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>800
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2314var"
FT   mRNA            join(<14..283,525..>800)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2314var"
FT                   /product="MHC class I antigen"
FT   CDS             join(<14..283,525..>800)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2314var"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:A2TH17"
FT                   /db_xref="IMGT/HLA:A*24:71"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:A2TH17"
FT                   /protein_id="ABM89227.1"
FT                   /translation="SHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDEETGKVKAHSQTDRENLRIALRYYNQSEAGSHTLQMMFGCDVGS
FT                   DGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQITKRKWEAARVAEQQRAYLEGTC
FT                   VDGLRRYLENGKETLQRT"
FT   exon            14..283
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2314var"
FT                   /number=2
FT   exon            525..800
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*2314var"
FT                   /number=3
XX
SQ   Sequence 800 BP; 145 A; 260 C; 284 G; 111 T; 0 other;
     tcctcgtccc caggctccca ctccatgagg tatttctcca catccgtgtc ccggcccggc        60
     cgcggggagc cccgcttcat cgccgtgggc tacgtggacg acacgcagtt cgtgcggttc       120
     gacagcgacg ccgcgagcca gaggatggag ccgcgggcgc cgtggataga gcaggagggg       180
     ccggagtatt gggacgagga gacagggaaa gtgaaggccc actcacagac tgaccgagag       240
     aacctgcgga tcgcgctccg ctactacaac cagagcgagg ccggtgagtg accccggccc       300
     ggggcgcagg tcacgacccc tcatccccca cggacgggcc gggtcgccca cagtctccgg       360
     gtccgagatc caccccgaag ccgcgggacc ccgagaccct tgccccggga gaggcccagg       420
     cgccttaacc cggtttcatt ttcagtttag gccaaaaatc cccccgggtt ggtcggggcc       480
     gggcggggct cgggggactg ggctgaccgc ggggtcgggg ccaggttctc acaccctcca       540
     gatgatgttt ggctgcgacg tggggtcgga cgggcgcttc ctccgcgggt accaccagta       600
     cgcctacgac ggcaaggatt acatcgccct gaaagaggac ctgcgctctt ggaccgcggc       660
     ggacatggcg gctcagatca ccaagcgcaa gtgggaggcg gcccgtgtgg cggagcagca       720
     gagagcctac ctggagggca cgtgcgtgga cgggctccgc agatacctgg agaacgggaa       780
     ggagacgctg cagcgcacgg                                                   800
//


spacer
spacer