spacer

EBI Dbfetch

ID   EF196873; SV 1; linear; genomic DNA; STD; HUM; 393 BP.
XX
AC   EF196873;
XX
DT   23-JAN-2007 (Rel. 90, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1*1308 variant
DE   allele, exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-393
RX   DOI; 10.1111/j.1399-0039.2007.00835.x.
RX   PUBMED; 17498272.
RA   Abdeen H., McErlean C., Moraes M.E., Torres M., Campiotto S., Galvao S.,
RA   Gouvea C., Middleton D.;
RT   "Identification of three novel alleles of HLA-DRB1 and HLA-A in the
RT   Brazilian population";
RL   Tissue Antigens 69(6):607-610(2007).
XX
RN   [2]
RP   1-393
RA   Abdeen H., McErlean C., Moraes M.E., Middleton D.;
RT   ;
RL   Submitted (22-DEC-2006) to the INSDC.
RL   Northern Ireland Histocompatibility and Immunogenetics, Belfast City
RL   Hospital, Lisburn Road, Belfast BT9 7TS, UK
XX
DR   MD5; 8cbc0cd9fe3502ac1165904c78520b2c.
DR   Ensembl-Gn; ENSG00000206240; homo_sapiens.
DR   Ensembl-Gn; ENSG00000206306; homo_sapiens.
DR   Ensembl-Tr; ENST00000328980; homo_sapiens.
DR   Ensembl-Tr; ENST00000399450; homo_sapiens.
DR   Ensembl-Tr; ENST00000415796; homo_sapiens.
DR   Ensembl-Tr; ENST00000428566; homo_sapiens.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..393
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>393
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*1308 variant"
FT   mRNA            <85..>354
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*1308 variant"
FT                   /product="MHC class II antigen"
FT   CDS             <85..>354
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*1308 variant"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:Q5Y7A7"
FT                   /db_xref="HGNC:HGNC:4948"
FT                   /db_xref="IMGT/HLA:DRB1*13:76"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q5Y7A7"
FT                   /protein_id="ABM69041.1"
FT                   /translation="RFLEYSTSECHFFNGTERVRFLDRYFHNQEEFVRFDSDVGEYRAV
FT                   TELGRPDAEYWNSQKDILEDERAEVDTYCRHNYGVVESFTVQRR"
FT   exon            85..354
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*1308 variant"
FT                   /number=2
XX
SQ   Sequence 393 BP; 72 A; 100 C; 145 G; 76 T; 0 other;
     cccagggagc cccggatggt ggcgtcactg tcagtgtctt ctcaggaggc cgcctgtgtg        60
     actggatcgt tcgtgtcccc acagcacgtt tcttggagta ctctacgtct gagtgtcatt       120
     tcttcaatgg gacggagcgg gtgcggttcc tggacagata cttccataac caggaggagt       180
     tcgtgcgctt cgacagcgac gtgggggagt accgggcggt gacggagctg gggcggcctg       240
     atgccgagta ctggaacagc cagaaggaca tcctggaaga cgagcgggcc gaggtggaca       300
     cctattgcag acacaactac ggggttgtgg agagcttcac agtgcagcgg cgaggtgagc       360
     gcggcgcggg gcggggcctg agtccctgtg agc                                    393
//


spacer
spacer