spacer

EBI Dbfetch

ID   EF195125; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   EF195125;
XX
DT   30-JAN-2007 (Rel. 90, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 2)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*40060101 new allele,
DE   exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RA   Wang Z., Wang L., He X., Liu N., Ni L., Wang L., Cui S., Zhao B., Gong Z.,
RA   Li W., Zhang Z., Shan X.;
RT   "Identification of a novel HLA-B allele HLA-B*40060101N in Chinese Bone
RT   Marrow Donor";
RL   Unpublished.
XX
RN   [2]
RP   1-270
RA   Wang Z., Wang L., He X., Liu N., Ni L., Wang L., Cui S., Zhao B., Gong Z.,
RA   Li W., Zhang Z., Shan X.;
RT   ;
RL   Submitted (20-DEC-2006) to the INSDC.
RL   HLA Laboratory, Beijing Red Cross Blood Center, No.37 Beisanhuan Zhonglu,
RL   Beijing 100088, China
XX
DR   MD5; 8abecbcebea13351fde81cc10aec0766.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6q21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40060101 new"
FT   mRNA            <1..>270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40060101 new"
FT                   /product="MHC class I antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40060101 new"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:A2TEM8"
FT                   /db_xref="IMGT/HLA:B*40:75"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:A2TEM8"
FT                   /protein_id="ABM90637.1"
FT                   /translation="SHSMRYFHTSVXRPGRGEPRFITVGYVDDTLFVRFDSDATSPRKE
FT                   PRAPWIXQEGPEYWDRETQICKTNTQTYRESLRNLRGYYNQSEA"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*40060101 new"
FT                   /number=2
FT   variation       199
FT                   /gene="HLA-B"
FT                   /replace="c"
XX
SQ   Sequence 270 BP; 59 A; 85 C; 88 G; 36 T; 2 other;
     gctcccactc catgaggtat ttccacacct ccgtgtnccg gcccggccgc ggggagcccc        60
     gcttcatcac cgtgggctac gtggacgaca cgctgttcgt gaggttcgac agcgacgcca       120
     cgagtccgag gaaggagccg cgggcgccat ggatanagca ggaggggccg gagtattggg       180
     accgggagac acagatctgc aagaccaaca cacagactta ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg                                        270
//


spacer
spacer