spacer

EBI Dbfetch

ID   EF195124; SV 1; linear; genomic DNA; STD; HUM; 276 BP.
XX
AC   EF195124;
XX
DT   30-JAN-2007 (Rel. 90, Created)
DT   27-JUN-2013 (Rel. 117, Last updated, Version 3)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*39010101 new allele,
DE   exon 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-276
RX   DOI; 10.1111/tan.12085.
RX   PUBMED; 23489407.
RA   Ni L., Shan X., Wang L., Zhixin Z., Gong Z.;
RT   "Identification of the novel HLA-B allele, HLA-B*39:42, in a Chinese
RT   individual";
RL   Tissue Antigens 81(6):461-462(2013).
XX
RN   [2]
RP   1-276
RA   Li W., Wang L., He X., Wang Z., Liu N., Ni L., Wang L., Cui S., Zhao B.,
RA   Gong Z., Shan X., Zhang Z.;
RT   "Identification of a novel HLA-B allele HLA-B*39010101N in Chinese Bone
RT   Marrow Donor";
RL   Unpublished.
XX
RN   [3]
RP   1-276
RA   Li W., Wang L., He X., Wang Z., Liu N., Ni L., Wang L., Cui S., Zhao B.,
RA   Gong Z., Shan X., Zhang Z.;
RT   ;
RL   Submitted (20-DEC-2006) to the INSDC.
RL   HLA Laboratory, Beijing Red Cross Blood Center, No.37 Beisanhuan Zhonglu,
RL   Beijing 100088, China
XX
DR   MD5; 161a0809137c5e27d849ade249a69e12.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..276
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6q21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>276
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*39010101 new"
FT   mRNA            <1..>276
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*39010101 new"
FT                   /product="MHC class I antigen"
FT   CDS             <1..>276
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*39010101 new"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:A2TEM7"
FT                   /db_xref="IMGT/HLA:B*39:42"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:A2TEM7"
FT                   /protein_id="ABM90636.1"
FT                   /translation="SHIIQRMYGCDVGPDGRLLRGHNQFAYDGKDYIALNEDLSSWTAA
FT                   DTAAQITQRKWEAARVAEQLRTYLEGTCVEWLRRYLENGKETLQRA"
FT   exon            1..276
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*39010101 new"
FT                   /number=3
FT   variation       10
FT                   /gene="HLA-B"
FT                   /replace="c"
FT   variation       12
FT                   /gene="HLA-B"
FT                   /replace="c"
XX
SQ   Sequence 276 BP; 55 A; 84 C; 101 G; 36 T; 0 other;
     ggtctcacat catccagagg atgtacggct gcgacgtggg gccggacggg cgcctcctcc        60
     gcgggcataa ccagttcgcc tacgacggca aggattacat cgccctgaac gaggacctga       120
     gctcctggac cgcggcggac accgcggctc agatcaccca gcgcaagtgg gaggcggccc       180
     gtgtggcgga gcagctgaga acctacctgg agggcacgtg cgtggagtgg ctccgcagat       240
     acctggagaa cgggaaggag acgctgcagc gcgcgg                                 276
//


spacer
spacer