spacer

EBI Dbfetch

ID   EF195123; SV 1; linear; genomic DNA; STD; HUM; 276 BP.
XX
AC   EF195123;
XX
DT   30-JAN-2007 (Rel. 90, Created)
DT   07-APR-2013 (Rel. 116, Last updated, Version 3)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*1301 new allele, exon
DE   3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-276
RX   PUBMED; 22978467.
RA   Wang L., Zhang Z.X., Shan X.Y., Wei L., Wang L.J.;
RT   "Identification of a novel HLA-B allele HLA-B*13:20 in a Chinese
RT   individual";
RL   Tissue Antigens 81(1):51-53(2013).
XX
RN   [2]
RP   1-276
RA   Liu N., Wang L., He X., Ni L., Wang Z., Wang L., Cui S., Zhao B., Gong Z.,
RA   Li W., Zhang Z., Shan X.;
RT   "Identification of a novel HLA-B allele HLA-B*1301N in Chinese Bone Marrow
RT   Donor";
RL   Unpublished.
XX
RN   [3]
RP   1-276
RA   Liu N., Wang L., He X., Ni L., Wang Z., Wang L., Cui S., Zhao B., Gong Z.,
RA   Li W., Zhang Z., Shan X.;
RT   ;
RL   Submitted (20-DEC-2006) to the INSDC.
RL   HLA Laboratory, Beijing Red Cross Blood Center, No.37 Beisanhuan Zhonglu,
RL   Beijing 100088, China
XX
DR   MD5; e5e6c64b652356afd7f755429fe60bcd.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..276
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6q21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>276
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1301 new"
FT   mRNA            <1..>276
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1301 new"
FT                   /product="MHC class I antigen"
FT   CDS             <1..>276
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1301 new"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:A2TEM6"
FT                   /db_xref="IMGT/HLA:B*13:20"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:A2TEM6"
FT                   /protein_id="ABM90635.1"
FT                   /translation="SHIIQRMYGCDLGPDGRLLRGHNQLAYDGKDYIALNEDLSSWTAA
FT                   DTAAQITQLKWEAAREAEQLRAYLEGECVEWLRRYLENGKETLQRA"
FT   exon            1..276
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1301 new"
FT                   /number=3
FT   variation       184
FT                   /gene="HLA-B"
FT                   /replace="t"
XX
SQ   Sequence 276 BP; 56 A; 82 C; 101 G; 37 T; 0 other;
     ggtctcacat catccagagg atgtatggct gcgacctggg gccggacggg cgcctcctcc        60
     gcgggcataa ccagttagcc tacgacggca aggattacat cgccctgaac gaggacctga       120
     gctcctggac cgcggcggac accgcggctc agatcaccca gctcaagtgg gaggcggccc       180
     gtgaggcgga gcagctgaga gcctacctgg agggcgagtg cgtggagtgg ctccgcagat       240
     acctggagaa cgggaaggag acgctgcagc gcgcgg                                 276
//


spacer
spacer