spacer

EBI Dbfetch

ID   EF189140; SV 1; linear; genomic DNA; STD; HUM; 826 BP.
XX
AC   EF189140;
XX
DT   15-JAN-2007 (Rel. 90, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 2)
XX
DE   Homo sapiens MHC class I antigen (HLA-C) gene, HLA-C*01new allele, exons 2,
DE   3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-826
RA   Ding L., Lin W., Wu Y., Chen S., Fu Y., Xu A.;
RT   "A novel HLA-Cw*01 allele isolated from the Han Chinese";
RL   Unpublished.
XX
RN   [2]
RP   1-826
RA   Ding L., Lin W., Wu Y., Chen S., Fu Y., Xu A.;
RT   ;
RL   Submitted (15-DEC-2006) to the INSDC.
RL   Department of Biochemistry, Institution of Life Sciences, Road XinGang Xi,
RL   Guangzhou, Guangdong 510275, China
XX
DR   MD5; 756b0c2cd71b1e493e4213efd7155019.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..826
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>804
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*01new"
FT   mRNA            join(<1..270,517..>804)
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*01new"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,517..>804)
FT                   /codon_start=3
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*01new"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:A2IBK3"
FT                   /db_xref="IMGT/HLA:C*01:19"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:A2IBK3"
FT                   /protein_id="ABM64722.1"
FT                   /translation="SHSMKYFFTSVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPRGE
FT                   PRAPWVEQEGPEYWDRETQKYKRQAQTDRVCLRNLRGYYNQSEAGSHTLQWMCGCDLGP
FT                   DGRLLRGYDQYAYDGKDYIALNEDLRSWTAADTAAQITQRKWEAAREAEQRRAYLEGTC
FT                   VEWLRRYLENGKETPQRAGTRG"
FT   exon            1..270
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*01new"
FT                   /number=2
FT   exon            517..804
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*01new"
FT                   /number=3
XX
SQ   Sequence 826 BP; 146 A; 273 C; 293 G; 114 T; 0 other;
     gctcccactc catgaagtat ttcttcacat ccgtgtcccg gcctggccgc ggagagcccc        60
     gcttcatctc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagtccgag aggggagccg cgggcgccgt gggtggagca ggaggggccg gagtattggg       180
     accgggagac acagaagtac aagcgccagg cacagactga ccgagtgtgc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg gtgagtgacc ccggcccggg gcgcaggtca       300
     cgacccctcc tcatccccca cggacggccc gggtcgcccc aagtctcccg gtctgagatc       360
     caccccgagg ctgcggaacc cgcccagacc ctcgaccgga gagagcccca gtcaccttta       420
     cccggtttca ttttcagttt aggccaaaat ccccgcgggt tggtcgggac tggggcgggg       480
     ctcgggggac ggggctgacc acgggggcgg ggccagggtc tcacaccctc cagtggatgt       540
     gtggctgcga cctggggccc gacgggcgcc tcctccgcgg gtatgaccag tacgcctacg       600
     acggcaagga ttacatcgcc ctgaacgagg acctgcgctc ctggaccgcc gcggacaccg       660
     cggctcagat cacccagcgc aagtgggagg cggcccgtga ggcggagcag cggagagcct       720
     acctggaggg cacgtgcgtg gagtggctcc gcagatacct ggagaacggg aaggagacgc       780
     cgcagcgcgc gggtaccagg ggcagtgggg agccttcccc atctcc                      826
//


spacer
spacer