spacer

EBI Dbfetch

ID   EF158822; SV 2; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   EF158822;
XX
DT   10-JAN-2007 (Rel. 90, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 5)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1*0464 allele,
DE   exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RX   DOI; 10.1111/j.1399-0039.2007.00856.x.
RX   PUBMED; 17559590.
RA   Endres R.O., Wetzsteon P.J., Stein J., Norman D.J.;
RT   "A novel DRB1*04 allele";
RL   Tissue Antigens 70(1):76-78(2007).
XX
RN   [2]
RP   1-270
RA   Endres R.O., Norman D.J., Wetzsteon P.J., Stein J.;
RT   ;
RL   Submitted (05-DEC-2006) to the INSDC.
RL   HLA Laboratory, Blood Systems Laboratories, 2424 W. Erie Drive, Tempe, AZ
RL   85282, USA
XX
RN   [3]
RC   Sequence update by submitter
RP   1-270
RA   Endres R.O., Norman D.J., Wetzsteon P.J., Stein J.;
RT   ;
RL   Submitted (26-JAN-2007) to the INSDC.
RL   HLA Laboratory, Blood Systems Laboratories, 2424 W. Erie Drive, Tempe, AZ
RL   85282, USA
XX
DR   MD5; a726575140cadb333ffbcd9289c1d4cf.
XX
CC   On Jan 26, 2007 this sequence version replaced gi:120969480.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*0464"
FT   mRNA            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*0464"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*0464"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:A1Z1P0"
FT                   /db_xref="IMGT/HLA:DRB1*04:64"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:A1Z1P0"
FT                   /protein_id="ABM45857.2"
FT                   /translation="RFLEQVKYECHFFNGTERVRFLDRYFYHQEEYVRFDSDVGEYRAV
FT                   TELGRPDAEYWNSQKDLLEQKRAAVDTYCRHNYGVGESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*0464"
FT                   /number=2
XX
SQ   Sequence 270 BP; 60 A; 64 C; 97 G; 49 T; 0 other;
     cacgtttctt ggagcaggtt aaatatgagt gtcatttctt caacgggacg gagcgggtgc        60
     ggttcctgga cagatacttc tatcaccaag aggagtacgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctgatgc cgagtactgg aacagccaga       180
     aggacctcct ggagcagaag cgggccgcgg tggacaccta ctgcagacac aactacgggg       240
     ttggtgagag cttcacagtg cagcggcgag                                        270
//


spacer
spacer