spacer

EBI Dbfetch

ID   EF141101; SV 1; linear; genomic DNA; STD; HUM; 1957 BP.
XX
AC   EF141101;
XX
DT   23-DEC-2006 (Rel. 90, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*1825 allele, exons 1
DE   through 5 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1957
RA   Eller S.R., Iglehart B.S., Leffell M.S.;
RT   "Identification of a Novel Allele: B*1825";
RL   Unpublished.
XX
RN   [2]
RP   1-1957
RA   Eller S.R., Iglehart B.S., Leffell M.S.;
RT   ;
RL   Submitted (27-NOV-2006) to the INSDC.
RL   Medicine, Johns Hopkins University, 2041 E. Monument St, Baltimore, MD
RL   21205, USA
XX
DR   MD5; ddcd7688de99a18440a6932878ecf212.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1957
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1957
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1825"
FT   mRNA            join(<1..48,178..447,694..969,1542..1817,1922..>1957)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1825"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..48,178..447,694..969,1542..1817,1922..>1957)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1825"
FT                   /product="MHC class I antigen"
FT                   /note="major histocompatibility complex; human leukocyte
FT                   antigen class I-B locus"
FT                   /db_xref="GOA:A1YWK4"
FT                   /db_xref="IMGT/HLA:B*18:25"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:A1YWK4"
FT                   /protein_id="ABL84351.1"
FT                   /translation="LLLLWGAVALTETWAGSHSMRYFYTAMSRPGRGEPRFISVGYVDG
FT                   TQFVRFDSDAASPRTEPRAPWIEQEGPEYWDRNTQISKTNTQTYRESLRNLRGYYNQSE
FT                   AGSHTLQRMYGCDVGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWE
FT                   AARVAEQLRAYLEGTCVEWLRRHLENGKETLQRADPPKTHVTHHPISDHEATLRCWALG
FT                   FYPAEITLTWQRDGEDQTQDTELVETRPAGDRTFQKWAAVVVPSGEEQRYTCHVQHEGL
FT                   PKPLTLRWEPSSQSTIPIVG"
FT   exon            <1..48
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1825"
FT                   /number=1
FT   exon            178..447
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1825"
FT                   /number=2
FT   exon            694..969
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1825"
FT                   /number=3
FT   exon            1542..1817
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1825"
FT                   /number=4
FT   exon            1922..>1957
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*1825"
FT                   /number=5
XX
SQ   Sequence 1957 BP; 370 A; 615 C; 632 G; 340 T; 0 other;
     tcctcctgct gctctggggg gcagtggccc tgaccgagac ctgggccggt gagtgcgggg        60
     tcgggaggga aatggcctct gtggggagga gcgaggggac cgcaggcggg ggcgcaggac       120
     ctgaggagcc gcgccgggag gagggtcggg cgggtctcag cccctcctcg cccccaggct       180
     cccactccat gaggtatttc tacaccgcca tgtcccggcc cggccgcggg gagccccgct       240
     tcatctcagt gggctacgtg gacggcaccc agttcgtgag gttcgacagc gacgccgcga       300
     gtccgaggac ggagccccgg gcgccgtgga tagagcaaga ggggccggag tattgggacc       360
     ggaacacaca gatctccaag accaacacac agacttaccg agagagcctg cggaacctgc       420
     gcggctacta caaccagagc gaggccggtg agtgaccccg gcccggggcg caggtcacga       480
     ctccccatcc cccacgtacg gcccgggtcg ccccgagtct ccgggtccga gatccgcccc       540
     cctgaggccg cgggacccgc ccagaccctc gaccggcgag agccccaggc gcgtttaccc       600
     ggtttcattt tcagttgagg ccaaaatccc cgcgggttgg tcggggcggg gcggggctcg       660
     gggggacggg gctgaccgcg gggccggggc cagggtctca caccctccag aggatgtacg       720
     gctgcgacgt ggggccggac gggcgcctcc tccgcgggca tgaccagtcc gcctacgacg       780
     gcaaggatta catcgccctg aacgaggacc tgagctcctg gaccgcggcg gacaccgcgg       840
     ctcagatcac ccagcgcaag tgggaggcgg cccgtgtggc ggagcagctg agagcctacc       900
     tggagggcac gtgcgtggag tggctccgca gacacctgga gaacgggaag gagacgctgc       960
     agcgcgcggg taccaggggc agtggggagc cttccccatc tcctataggt cgccggggat      1020
     ggcctcccac gagaagagga ggaaaatggg atcagcgcta gaatgtcgcc ctcccttgaa      1080
     tggagaatgg catgagtttt cctgagtttc ctctgagggc cccctcttct ctctaggaca      1140
     attaagggat gacgtctctg aggaaatgga ggggaagaca gtccctagaa tactgatcag      1200
     gggtcccctt tgacccctgc agcagccttg ggaaccatga cttttcctct caggccttgt      1260
     tctctgcctc acactcagtg tgtttggggc tctgattcca gcacttctga gtcactttac      1320
     ctccactcag atcaggagca gaagtctctg ttccccgctc agagactcga actttccaat      1380
     gaatagatta tcccaggtgc ctgcgtccag gctggtgtct gggttctgtg ccccttcccc      1440
     accccaggtg tcctgtccat tctcaggctg gtcacatggg tggtcctagg gtgtcccatg      1500
     agagatgcaa agcgcctgaa ttttctgact cttcccatca gaccccccaa agacacatgt      1560
     gacccaccac cccatctctg accatgaggc caccctgagg tgctgggccc tgggcttcta      1620
     ccctgcggag atcacactga cctggcagcg ggatggcgag gaccaaactc aggacaccga      1680
     gcttgtggag accagaccag caggagatag aaccttccag aagtgggcag ctgtggtggt      1740
     gccttctgga gaagagcaga gatacacatg ccatgtacag catgaggggc tgccgaagcc      1800
     cctcaccctg agatggggta aggaggggga tgaggggtca tatctcttct cagggaaagc      1860
     aggagccctt ctggagccct tcagcagggt cagggcccct catcttcccc tcctttccca      1920
     gagccatctt cccagtccac catccccatc gtgggca                               1957
//


spacer
spacer