spacer

EBI Dbfetch

ID   EF136579; SV 1; linear; genomic DNA; STD; HUM; 786 BP.
XX
AC   EF136579;
XX
DT   21-FEB-2007 (Rel. 90, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*5411 allele, exons 2,
DE   3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-786
RX   DOI; 10.1111/j.1399-0039.2008.01026.x.
RX   PUBMED; 18346033.
RA   Yan L.N., Li S.Y., Dong Z., Dong L., Xie J.H., Yuan Y.H., An S.P.;
RT   "Identification of a novel HLA-B*54 allele, B*5411, by sequence-based
RT   typing in a Chinese individual";
RL   Tissue Antigens 71(5):484-485(2008).
XX
RN   [2]
RP   1-786
RA   Yan L.-N., An S.-P., Li S.-Y., Xie J.-H., Dong L., Dong Z.;
RT   "A new HLA-B*54 allele detected with SBT";
RL   Unpublished.
XX
RN   [3]
RP   1-786
RA   Yan L.-N., An S.-P., Li S.-Y., Xie J.-H., Dong L., Dong Z.;
RT   ;
RL   Submitted (21-NOV-2006) to the INSDC.
RL   Tissue Typing Lab, Tianjin Blood Center, No.424, Huanghe Road, Tianjin
RL   300110, China
XX
DR   MD5; 022bf8271cd51fcd484919b821a1eda9.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..786
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /tissue_type="blood"
FT                   /note="PCR_primers=fwd_name: HLA-B-E3F, rev_name:
FT                   HLA-B-E2R"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>786
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5411"
FT   mRNA            join(<1..270,511..>786)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5411"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,511..>786)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5411"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:A3EYJ3"
FT                   /db_xref="IMGT/HLA:B*54:11"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:A3EYJ3"
FT                   /protein_id="ABN58810.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRGE
FT                   PRAPWVEQEGPEYWDRNTQIYKAQAQTDRESLRNLRGYYNQSEAGSHTWQTMYGCDLGP
FT                   DGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTAAQISQRKWEAARVAEQLRAYLEGTC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5411"
FT                   /number=2
FT   gap             271..510
FT                   /estimated_length=240
FT   exon            511..786
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5411"
FT                   /number=3
FT   variation       630
FT                   /gene="HLA-B"
FT                   /replace="a"
FT   variation       644
FT                   /gene="HLA-B"
FT                   /replace="g"
FT   variation       653
FT                   /gene="HLA-B"
FT                   /replace="c"
FT   variation       666
FT                   /gene="HLA-B"
FT                   /replace="a"
XX
SQ   Sequence 786 BP; 106 A; 171 C; 198 G; 71 T; 240 other;
     gctcccactc catgaggtat ttctacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagtccgag aggggagccg cgggcgccgt gggtggagca ggaggggccg gagtattggg       180
     accggaacac acagatctac aaggcccagg cacagactga ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       420
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn ggtctcacac ttggcagacg atgtatggct       540
     gcgacctggg gccggacggg cgcctcctcc gcgggcataa ccagtacgcc tacgacggca       600
     aggattacat cgccctgaac gaggacctgc gctcctggac cgccgcggac acggcggctc       660
     agatctccca gcgcaagtgg gaggcggccc gtgtggcgga gcagctgaga gcctacctgg       720
     agggcacgtg cgtggagtgg ctccgcagat acctggagaa cgggaaggag acgctgcagc       780
     gcgcgg                                                                  786
//


spacer
spacer