spacer

EBI Dbfetch

ID   EF103190; SV 1; linear; genomic DNA; STD; HUM; 270 BP.
XX
AC   EF103190;
XX
DT   25-NOV-2006 (Rel. 89, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens MHC class II antigen (HLA-DRB1) gene, HLA-DRB1*14 variant
DE   allele, exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-270
RX   DOI; 10.1111/j.1399-0039.2007.00850.x.
RX   PUBMED; 17559589.
RA   Kwon O.J., Park S.Y., Oh J.W., Nah S.Y., Jeong S.M.;
RT   "Characterization of a new HLA-DRB1*1405 variant, HLA-DRB1*140503,
RT   identified by sequence-based typing";
RL   Tissue Antigens 70(1):75-76(2007).
XX
RN   [2]
RP   1-270
RA   Hur S.S., Lee J.S., Park S.Y., Hong S.A., Kwon O.J.;
RT   "New HLA-DRB1*140501 variant allele";
RL   Unpublished.
XX
RN   [3]
RP   1-270
RA   Hur S.S., Lee J.S., Park S.Y., Hong S.A., Kwon O.J.;
RT   ;
RL   Submitted (18-OCT-2006) to the INSDC.
RL   Molecular Genetics, BioSewoom Institute of Bioscience & Biotechnology,
RL   Wooyoung Technocenter 1F, #273-15, Sungsu 2-ga 3-dong, Sungdong-gu, Seoul
RL   133-831, Republic of Korea
XX
DR   MD5; aa8743c03c736f702343e8a0575849ae.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..270
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*14 variant"
FT   mRNA            <1..>270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*14 variant"
FT                   /product="MHC class II antigen"
FT   CDS             <1..>270
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*14 variant"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:A0T4C2"
FT                   /db_xref="IMGT/HLA:DRB1*14:05:03"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:A0T4C2"
FT                   /protein_id="ABK63712.1"
FT                   /translation="RFLEYSTSECQFFNGTERVRFLDRYFHNQEEFVRFDSDVGEYRAV
FT                   TELGRPDAEYWNSQKDLLERRRAEVDTYCRHNYGVVESFTVQRR"
FT   exon            1..270
FT                   /gene="HLA-DRB1"
FT                   /allele="HLA-DRB1*14 variant"
FT                   /number=2
XX
SQ   Sequence 270 BP; 56 A; 64 C; 99 G; 51 T; 0 other;
     cacgtttctt ggagtactct acgtctgagt gtcaattctt caatgggacg gagcgggtgc        60
     ggttcctgga cagatacttc cataaccagg aggagttcgt gcgcttcgac agcgacgtgg       120
     gggagtaccg ggcggtgacg gagctggggc ggcctgatgc tgagtactgg aacagccaga       180
     aggacctcct ggagcggagg cgggccgagg tggacaccta ctgcagacac aactacgggg       240
     ttgtggagag cttcacagtg cagcggcgag                                        270
//


spacer
spacer