spacer

EBI Dbfetch

ID   EF101896; SV 1; linear; genomic DNA; STD; HUM; 992 BP.
XX
AC   EF101896;
XX
DT   12-DEC-2006 (Rel. 90, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 2)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*15var allele, partial
DE   cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-992
RA   Wang C., Miao K.;
RT   "HLA-B*15var in China";
RL   Unpublished.
XX
RN   [2]
RP   1-992
RA   Wang C., Miao K., Pan Q.;
RT   ;
RL   Submitted (03-NOV-2006) to the INSDC.
RL   HLA Lab, Jiangsu Province Ho, 300# Guangzhou Road, Nanjing, Jiangsu 210029,
RL   China
XX
DR   MD5; 2bdfefb9d46a803fce0ec4cd970691fc.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..992
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>992
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*15var"
FT   mRNA            join(<1..73,202..471,717..>992)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*15var"
FT                   /product="MHC class I antigen"
FT   CDS             join(1..73,202..471,717..>992)
FT                   /codon_start=1
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*15var"
FT                   /product="MHC class I antigen"
FT                   /note="presents antigen to CD8+ T cells for lysis"
FT                   /db_xref="GOA:A1E2R4"
FT                   /db_xref="IMGT/HLA:B*15:68"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:A1E2R4"
FT                   /protein_id="ABK96978.1"
FT                   /translation="MLVMAPRTVLLLLSAALALTETWAGSHSMRYFYTSVSRPGRGEPR
FT                   FISVGYVDDTQFVRFDSDAASPREEPRAPWIEQEGPEYWDRETQISKTNTQTYRESLRN
FT                   LRGYYNQSEAGSHTLQSMYGCDVGPDGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTA
FT                   AQITQRKWEAAREAEQWRAYLEGLCVEWLRRYLENGKETLQRA"
XX
SQ   Sequence 992 BP; 166 A; 330 C; 367 G; 129 T; 0 other;
     atgctggtca tggcgccccg aaccgtcctc ctgctgctct cggcggccct ggccctgacc        60
     gagacctggg ccggtgagtg cgggtcggga gggaaatggc ctctgccggg aggagcgagg       120
     ggaccgcagg cgggggcgca ggacctgagg agccgcgccg ggaggagggt cgggcgggtc       180
     tcagcccctc ctcaccccca ggctcccact ccatgaggta tttctacacc tccgtgtccc       240
     ggcccggccg cggggagccc cgcttcatct cagtgggcta cgtggacgac acccagttcg       300
     tgaggttcga cagcgacgcc gcgagtccga gagaggagcc gcgggcgccg tggatagagc       360
     aggaggggcc ggagtattgg gaccgggaga cacagatctc caagaccaac acacagactt       420
     accgagagag cctgcggaac ctgcgcggct actacaacca gagcgaggcc ggtgagtgac       480
     cccggcccgg ggcgcaggtc acgactcccc atcccccacg tacggcccgg gtcgccccga       540
     gtctccgggt ccgagatccg cctccctgag gccgcgggac ccgcccagac cctcgaccgg       600
     cgagagcccc aggcgcgttt acccggtttc attttcagtt gaggccaaaa tccccgcggg       660
     ttggtcgggg cggggcgggg ctcgggggac tgggctgacc gcggggccgg ggccagggtc       720
     tcacaccctc cagagcatgt acggctgcga cgtggggccg gacgggcgcc tcctccgcgg       780
     gcatgaccag tccgcctacg acggcaagga ttacatcgcc ctgaacgagg acctgagctc       840
     ctggaccgcg gcggacacgg cggctcagat cacccagcgc aagtgggagg cggcccgtga       900
     ggcggagcag tggagagcct acctggaggg cctgtgcgtg gagtggctcc gcagatacct       960
     ggagaacggg aaggagacgc tgcagcgcgc gg                                     992
//


spacer
spacer