spacer

EBI Dbfetch

ID   EF092417; SV 1; linear; genomic DNA; STD; HUM; 646 BP.
XX
AC   EF092417;
XX
DT   11-DEC-2006 (Rel. 90, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 2)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*02new allele, exons 2,
DE   3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-646
RA   Yan L., Zhu F., He J.;
RT   "Identification of a new HLA-A*02 allele by SBT";
RL   Unpublished.
XX
RN   [2]
RP   1-646
RA   Yan L., Zhu f., He J.;
RT   ;
RL   Submitted (29-OCT-2006) to the INSDC.
RL   HLA Typing Lab, The Blood Center of Zhejiang Province, Wulin Road 345,
RL   Hangzhou, Zhejiang 310006, China
XX
DR   MD5; a346b588cee0eabf7cc1e088f4326c1d.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..646
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>646
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02new"
FT   mRNA            <2..>270
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02new"
FT                   /product="MHC class I antigen"
FT   CDS             <2..>270
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02new"
FT                   /product="MHC class I antigen"
FT                   /note="coding region disrupted by sequencing gap"
FT                   /db_xref="GOA:A1E126"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:A1E126"
FT                   /protein_id="ABL09833.1"
FT                   /translation="SHSMRYFYTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDGETRKVKAHSQTHRVDLGTLRGYYNQSEA"
FT   exon            2..>270
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02new"
FT                   /number=2
FT   gap             271..370
FT                   /estimated_length=unknown
FT   mRNA            <371..>646
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02new"
FT                   /product="MHC class I antigen"
FT   CDS             <371..>646
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02new"
FT                   /product="MHC class I antigen"
FT                   /note="coding region disrupted by sequencing gap"
FT                   /db_xref="GOA:A1E127"
FT                   /db_xref="IMGT/HLA:A*02:108"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:A1E127"
FT                   /protein_id="ABL09834.1"
FT                   /translation="SHTLQMMFGCDVGSDWRFLRGYHQYAYDGKDYIALKEDLRSWTAA
FT                   DMAAQTTKHKWEAAHVAEQLRAYLEGTCVEWLRRYLENGKETLQRT"
FT   exon            371..646
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*02new"
FT                   /number=3
XX
SQ   Sequence 646 BP; 110 A; 163 C; 192 G; 81 T; 100 other;
     ggctctcact ccatgaggta tttctacacc tccgtgtccc ggcccggccg cggggagccc        60
     cgcttcatcg cagtgggcta cgtggacgac acgcagttcg tgcggttcga cagcgacgcc       120
     gcgagccaga ggatggagcc gcgggcgccg tggatagagc aggagggtcc ggagtattgg       180
     gacggggaga cacggaaagt gaaggcccac tcacagactc accgagtgga cctggggacc       240
     ctgcgcggct actacaacca gagcgaggcc nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn gttctcacac cctccagatg atgtttggct gcgacgtggg gtcggactgg       420
     cgcttcctcc gcgggtacca ccagtacgcc tacgacggca aggattacat cgccctgaaa       480
     gaggacctgc gctcttggac cgcggcggac atggcagctc agaccaccaa gcacaagtgg       540
     gaggcggccc atgtggcgga gcagttgaga gcctacctgg agggcacgtg cgtggagtgg       600
     ctccgcagat acctggagaa cgggaaggag acgctgcagc gcacgg                      646
//


spacer
spacer