spacer

EBI Dbfetch

ID   EF088200; SV 1; linear; genomic DNA; STD; HUM; 796 BP.
XX
AC   EF088200;
XX
DT   12-DEC-2006 (Rel. 90, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 2)
XX
DE   Homo sapiens MHC class I antigen (HLA-C) gene, HLA-C*07New allele, exons 2,
DE   3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-796
RA   Fry J., Diviney M., Kanaan C., Tait B., Holdsworth R., Plata M.;
RT   "New HLA-A, -B, -Cw allele sequences discovered during routine HLA tissue
RT   typing";
RL   Unpublished.
XX
RN   [2]
RP   1-796
RA   Fry J., Diviney M., Kanaan C., Tait B., Holdsworth R., Plata M.;
RT   ;
RL   Submitted (24-OCT-2006) to the INSDC.
RL   Victorian Transplant and Immunogenetics Service, Australian Red Cross Blood
RL   Service, Level 2, Rotary Bone Marrow Building, Royal Pde., Parkville,
RL   Victoria 3050, Australia
XX
DR   MD5; dbb01d5cb5c4649ccfe44a0230c44655.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..796
FT                   /organism="Homo sapiens"
FT                   /isolate="C.135203C05"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>796
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*07New"
FT   mRNA            join(<1..270,521..>796)
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*07New"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,521..>796)
FT                   /codon_start=3
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*07New"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:A1DZT8"
FT                   /db_xref="IMGT/HLA:C*07:44"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:A1DZT8"
FT                   /protein_id="ABK97603.1"
FT                   /translation="SHSMRYFDTAVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPRGE
FT                   PRAPWVEQEGPEYWDRETQNYKRQAQADRVSLRNLRGYYNQSEDGSHTLQRMYGCDLGP
FT                   DGRLLRGYDQSAYDGKDYIALNEDLRSWTAADYAAQITQRKLEAARAAEQLRAYLEGTC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            1..279
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*07New"
FT                   /number=2
FT   gap             271..520
FT                   /estimated_length=250
FT   exon            521..796
FT                   /gene="HLA-C"
FT                   /allele="HLA-C*07New"
FT                   /number=3
XX
SQ   Sequence 796 BP; 105 A; 173 C; 197 G; 71 T; 250 other;
     gctcccactc catgaggtat ttcgacaccg ccgtgtcccg gcccggccgc ggagagcccc        60
     gcttcatctc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagtccgag aggggagccg cgggcgccgt gggtggagca ggaggggccg gagtattggg       180
     accgggagac acagaactac aagcgccagg cacaggctga ccgagtgagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggacg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       420
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn ggtctcacac cctccagagg       540
     atgtatggct gcgacctggg gcccgacggg cgcctcctcc gcgggtatga ccagtccgcc       600
     tacgacggca aggattacat cgccctgaac gaggacctgc gctcctggac cgccgcggac       660
     tacgcggctc agatcaccca gcgcaagttg gaggcggccc gtgcggcgga gcagctgaga       720
     gcctacctgg agggcacgtg cgtggagtgg ctccgcagat acctggagaa cgggaaggag       780
     acgctgcagc gcgcag                                                       796
//


spacer
spacer