spacer

EBI Dbfetch

ID   EF081456; SV 1; linear; genomic DNA; STD; HUM; 811 BP.
XX
AC   EF081456;
XX
DT   11-DEC-2006 (Rel. 90, Created)
DT   10-JUN-2009 (Rel. 101, Last updated, Version 3)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*54V allele, exons 2, 3
DE   and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-811
RX   DOI; 10.1111/j.1399-0039.2009.01244.x.
RX   PUBMED; 19392795.
RA   Chu C.C., Lee K.C., Lee H.L., Lin M.;
RT   "Identification of HLA-B*5410 in Taiwan";
RL   Tissue Antigens 73(6):611-612(2009).
XX
RN   [2]
RP   1-811
RA   Chu C.-C.;
RT   ;
RL   Submitted (25-OCT-2006) to the INSDC.
RL   Medical Research Department, Mackay Memorial Hospital, Taiwan
XX
DR   MD5; 71e4899ff8b7df0e906a8976767cc9bf.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..811
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>811
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*54V"
FT   mRNA            join(<11..280,526..>801)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*54V"
FT                   /product="MHC class I antigen"
FT   CDS             join(<11..280,526..>801)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*54V"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:A1DZT3"
FT                   /db_xref="IMGT/HLA:B*54:10"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:A1DZT3"
FT                   /protein_id="ABL10358.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRGE
FT                   PRAPWVEQEGPEYWDRNTQIYKAQAQTDRESLRNLRGYYNQSEAGSHTWQTMYGCDLGP
FT                   DGRLLRGHNQLAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQRRAYLEGTC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            11..280
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*54V"
FT                   /number=2
FT   exon            526..801
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*54V"
FT                   /number=3
XX
SQ   Sequence 811 BP; 141 A; 268 C; 298 G; 104 T; 0 other;
     tcgcccccag gctcccactc catgaggtat ttctacaccg ccatgtcccg gcccggccgc        60
     ggggagcccc gcttcatcgc agtgggctac gtggacgaca cgcagttcgt gcggttcgac       120
     agcgacgccg cgagtccgag aggggagccg cgggcgccgt gggtggagca ggaggggccg       180
     gagtattggg accggaacac acagatctac aaggcccagg cacagactga ccgagagagc       240
     ctgcggaacc tgcgcggcta ctacaaccag agcgaggccg gtgagtgacc ccggcccggg       300
     gcgcaggtca cgactcccca tcccccacgt acggcccggg tcgccccgag tctccgggtc       360
     cgagatccgc ctccctgagg ccgcgggacc cgcccagacc ctcgaccggc gagagcccca       420
     ggcgcgttta cccggtttca ttttcagttg aggccaaaat ccccgcgggt tggtcggggc       480
     ggggcggggc tcgggggacg gggctgaccg cggggccggg gccagggtct cacacttggc       540
     agacgatgta tggctgcgac ctggggccgg acgggcgcct cctccgcggg cataaccagt       600
     tagcctacga cggcaaggat tacatcgccc tgaacgagga cctgagctcc tggaccgcgg       660
     cggacaccgc ggctcagatc acccagcgca agtgggaggc ggcccgtgtg gcggagcagc       720
     ggagagccta cctggagggc acgtgcgtgg agtggctccg cagatacctg gagaacggga       780
     aggagacgct gcagcgcgcg ggtaccaggg g                                      811
//


spacer
spacer