spacer

EBI Dbfetch

ID   EF062994; SV 1; linear; genomic DNA; STD; HUM; 1939 BP.
XX
AC   EF062994;
XX
DT   07-NOV-2006 (Rel. 89, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*68 variant allele,
DE   complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1939
RX   DOI; 10.1111/j.1399-0039.2006.00732.x.
RX   PUBMED; 17212713.
RA   Balas A., Garcia-Sanchez F., Vicario J.L.;
RT   "Sequencing of a novel HLA-A allele, A*6836, showing a Bw4 epitope";
RL   Tissue Antigens 69(1):99-100(2007).
XX
RN   [2]
RP   1-1939
RA   Balas A., Garcia-Sanchez F., Vicario J.L.;
RT   ;
RL   Submitted (16-OCT-2006) to the INSDC.
RL   Histocompatibility, Ctm, Avenida De La Democracia, Madrid 28032, Spain
XX
DR   MD5; abe78687fa5d2ee2c88980722d6dfbfe.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1939
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1939
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*68 variant"
FT   mRNA            join(<1..73,174..443,685..960,1061..1336,1437..1553,
FT                   1654..1686,1787..1834,1935..>1939)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*68 variant"
FT                   /product="MHC class I antigen"
FT   CDS             join(1..73,174..443,685..960,1061..1336,1437..1553,
FT                   1654..1686,1787..1834,1935..1939)
FT                   /codon_start=1
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*68 variant"
FT                   /product="MHC class I antigen"
FT                   /note="human leukocyte antigen"
FT                   /db_xref="GOA:A0N0E2"
FT                   /db_xref="IMGT/HLA:A*68:36"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR010579"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:A0N0E2"
FT                   /protein_id="ABK33463.1"
FT                   /translation="MAVMAPRTLVLLLSGALALTQTWAGSHSMRYFYTSVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDRNTRNVKAQSQTDRENLRI
FT                   ALRYYNQSEAGSHTIQMMYGCDVGSDGRFLRGYRQDAYDGKDYIALKEDLRSWTAADMA
FT                   AQTTKHKWEAAHVAEQWRAYLEGTCVEWLRRYLENGKETLQRTDAPKTHMTHHAVSDHE
FT                   ATLRCWALSFYPAEITLTWQRDGEDQTQDTELVETRPAGDGTFQKWVAVVVPSGQEQRY
FT                   TCHVQHEGLPKPLTLRWEPSSQPTIPIVGIIAGLVLFGAVITGAVVAAVMWRRKSSDRK
FT                   GGSYSQAASSDSAQGSDVSLTACKV"
FT   gap             74..173
FT                   /estimated_length=unknown
FT   gap             961..1060
FT                   /estimated_length=unknown
FT   gap             1337..1436
FT                   /estimated_length=unknown
FT   gap             1554..1653
FT                   /estimated_length=unknown
FT   gap             1687..1786
FT                   /estimated_length=unknown
FT   gap             1835..1934
FT                   /estimated_length=unknown
XX
SQ   Sequence 1939 BP; 254 A; 414 C; 454 G; 217 T; 600 other;
     atggccgtca tggcgccccg aaccctcgtc ctgctactct cgggggccct ggccctgacc        60
     cagacctggg cggnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       120
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnngctccca       180
     ctccatgagg tatttctaca cttccgtgtc ccggcccggc cgcggggagc cccgcttcat       240
     cgccgtgggc tacgtggacg acacgcagtt cgtgcggttc gacagcgacg ccgcgagcca       300
     gaggatggag ccgcgggcgc cgtggataga gcaggagggg ccggagtatt gggaccggaa       360
     cacacggaat gtgaaggccc agtcacagac tgaccgagag aacctgcgga tcgcgctccg       420
     ctactacaac cagagcgagg ccggtgagtg accccggccc ggggcgcagg tcacgacccc       480
     tcatccccca cggacgggcc aggtcgccca cagtctccgg gtccgagatc cgccccgaag       540
     ccgcgggacc ccgagaccct tgccccggga gaggcccagg cgcctttacc cggtttcatt       600
     ttcagtttag gccaaaaatc cccccgggtt ggtcggggcg gggcggggct cgggggaccg       660
     ggctgacctc ggggtccggg ccaggttctc acaccatcca gatgatgtat ggctgcgacg       720
     tggggtcgga cgggcgcttc ctccgcgggt accggcagga cgcctacgac ggcaaggatt       780
     acatcgccct gaaagaggac ctgcgctctt ggaccgcggc ggacatggca gctcagacca       840
     ccaagcacaa gtgggaggcg gcccatgtgg cggagcagtg gagagcctac ctggagggca       900
     cgtgcgtgga gtggctccgc agatacctgg agaacgggaa ggagacgctg cagcgcacgg       960
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1020
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn acgcccccaa aacgcatatg      1080
     actcaccacg ctgtctctga ccatgaagcc accctgaggt gctgggccct gagcttctac      1140
     cctgcggaga tcacactgac ctggcagcgg gatggggagg accagaccca ggacacggag      1200
     ctcgtggaga ccaggcctgc aggggatgga accttccaga agtgggtggc tgtggtggtg      1260
     ccttctggac aggagcagag atacacctgc catgtgcagc atgagggttt gcccaagccc      1320
     ctcaccctga gatgggnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1380
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnagcc      1440
     gtcttcccag cccaccatcc ccatcgtggg catcattgct ggcctggttc tctttggagc      1500
     tgtgatcact ggagctgtgg tcgctgctgt gatgtggagg aggaagagct cagnnnnnnn      1560
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1620
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnatagaaa aggagggagc tactctcagg      1680
     ctgcaannnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1740
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnngcag tgacagtgcc      1800
     cagggctctg atgtgtctct cacagcttgt aaagnnnnnn nnnnnnnnnn nnnnnnnnnn      1860
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn      1920
     nnnnnnnnnn nnnntgtga                                                   1939
//


spacer
spacer