Dbfetch

ID   EF062307; SV 2; linear; genomic DNA; STD; HUM; 3415 BP.
XX
AC   EF062307;
XX
DT   21-NOV-2006 (Rel. 89, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens truncated MHC class I antigen (HLA-A) gene, HLA-A*24new
DE   allele, complete cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-3415
RA   Yan L., Zhu F., He J.;
RT   "Identification of HLA-A*24new allele in the Chinese population";
RL   Unpublished.
XX
RN   [2]
RP   1-3415
RA   Yan L., Zhu F., He J.;
RT   ;
RL   Submitted (13-OCT-2006) to the INSDC.
RL   HLA Lab, Blood Center of Zhejiang Province, Wulin Road 345, Hangzhou,
RL   Zhejiang Province 310006, China
XX
RN   [3]
RC   Sequence update by submitter
RP   1-3415
RA   Yan L., Zhu F., He J.;
RT   ;
RL   Submitted (16-JAN-2008) to the INSDC.
RL   HLA Lab, Blood Center of Zhejiang Province, Wulin Road 345, Hangzhou,
RL   Zhejiang Province 310006, China
XX
DR   MD5; 0e1108b26db8b22f177b460c8a34c017.
XX
CC   On Jan 16, 2008 this sequence version replaced gi:118084544.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..3415
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            1..3415
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24new"
FT   mRNA            join(1..373,504..773,1015..1307,1887..2162,2265..2399,
FT                   2824..2856,2999..3046,3215..3415)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24new"
FT                   /product="truncated MHC class I antigen"
FT   exon            <1..373
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24new"
FT                   /number=1
FT   5'UTR           1..300
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24new"
FT   CDS             join(301..373,504..773,1015..1307,1887..1907)
FT                   /codon_start=1
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24new"
FT                   /product="truncated MHC class I antigen"
FT                   /note="frameshift in exon 3 leads to premature stop"
FT                   /db_xref="GOA:A0SY06"
FT                   /db_xref="IMGT/HLA:A*24:86N"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:A0SY06"
FT                   /protein_id="ABK60080.2"
FT                   /translation="MAVMAPRTLVLLLSGALALTQTWAGSHSMRYFSTSVSRPGRGEPR
FT                   FIAVGYVDDTQFVRFDSDAASQRMEPRAPWIEQEGPEYWDEETGKVKAHSQTDRENLRI
FT                   ALRYYNQSEAGSHTLQMMFGCDVGSDGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMA
FT                   AQITKRKWEAAHVAEQQRAYLEGTCVDGLRRYLENGKETLQRRRRCSARTPPRHI"
FT   exon            504..773
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24new"
FT                   /number=2
FT   exon            1015..1307
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24new"
FT                   /number=3
FT   exon            1887..2162
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24new"
FT                   /number=4
FT   3'UTR           join(1908..2162,2265..2399,2824..2856,2999..3046,
FT                   3215..3415)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24new"
FT   exon            2265..2399
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24new"
FT                   /number=5
FT   exon            2824..2856
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24new"
FT                   /number=6
FT   exon            2999..3046
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24new"
FT                   /number=7
FT   exon            3215..3415
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*24new"
FT                   /number=8
XX
SQ   Sequence 3415 BP; 658 A; 991 C; 1047 G; 719 T; 0 other;
     cagaagcaga ggggtcaggg cgaagtccca gggccccagg cgtggctctc agggtctcag        60
     gccccgaagg cggtgtatgg attggggagt cccagccttg gggattcccc aactccgcag       120
     tttcttttct ccctctccca acctatgtag ggtccttctt cctggatact cacgacgcgg       180
     acccagttct cactcccatt gggtgtcggg tttccagaga agccaatcag tgtcgtcgcg       240
     gtcgctgttc taaagtccgc acgcacccac cgggactcag attctcccca gacgccgagg       300
     atggccgtca tggcgccccg aaccctcgtc ctgctactct cgggggccct ggccctgacc       360
     cagacctggg caggtgagtg cggggtcggg agggaaacgg cctctgcggg gagaagcaag       420
     gggcccgcct ggcgggggcg caagacccgg gaagccgcgc cgggaggagg gtcgggcggg       480
     tctcagccac tcctcgtccc caggctccca ctccatgagg tatttctcca catccgtgtc       540
     ccggcccggc cgcggggagc cccgcttcat cgccgtgggc tacgtggacg acacgcagtt       600
     cgtgcggttc gacagcgacg ccgcgagcca gaggatggag ccgcgggcgc cgtggataga       660
     gcaggagggg ccggagtatt gggacgagga gacagggaaa gtgaaggccc actcacagac       720
     tgaccgagag aacctgcgga tcgcgctccg ctactacaac cagagcgagg ccggtgagtg       780
     accccggccc ggggcgcagg tcacgacccc tcatccccca cggacgggcc gggtcgccca       840
     cagtctccgg gtccgagatc caccccgaag ccgcgggacc ccgagaccct tgccccggga       900
     gaggcccagg cgccttaacc cggtttcatt ttcagtttag gccaaaaatc cccccgggtt       960
     ggtcggggcc gggcggggct cgggggactg ggctgaccgc ggggtcgggg ccaggttctc      1020
     acaccctcca gatgatgttt ggctgcgacg tggggtcgga cgggcgcttc ctccgcgggt      1080
     accaccagta cgcctacgac ggcaaggatt acatcgccct gaaagaggac ctgcgctctt      1140
     ggaccgcggc ggacatggcg gctcagatca ccaagcgcaa gtgggaggcg gcccatgtgg      1200
     cggagcagca gagagcctac ctggagggca cgtgcgtgga cgggctccgc agatacctgg      1260
     agaacgggaa ggagacgctg cagcgaagga gacgctgcag cgcacgggta ccaggggcca      1320
     cggggcgcct acctgatcgc ctgtaggtct cccgggctgg cctcccacaa ggaggggaga      1380
     caattgggac caacactaga atatcgccct ccctctggtc ctgagggaga ggaatcctcc      1440
     tgggtttcca gatcctgtac cagagagtga ctctgaggtt ccgccctgct ctctgacaca      1500
     attaagggat aaaatctctg acggaatgac ggaaagacga tccctcgaat actgatgact      1560
     ggttcccttt gacaccggca gcagccttgg gaccgtgact tttcctctca ggccttgttc      1620
     tctgcttcac actcaatgtg tgtgggggtc tgagtccagc acttctgagt ccctcagcct      1680
     ccactcaggt caggaccaga agtcgctgtt ccctcctcag ggaatagaag attatcccag      1740
     gtgcctgtgt ccaggctggt gtctgggttc tgtgctctct tccccatccc gggtgtcctg      1800
     tccattctca agatggccac atgcatgctg gtggagtgtc ccatgacaga tgcaaaatgc      1860
     ctgaattttc tgactcttcc cgtcagaccc ccccaagaca catatgaccc accaccccat      1920
     ctctgaccat gaggccactc tgagatgctg ggccctgggc ttctaccctg cggagatcac      1980
     actgacctgg cagcgggatg gggaggacca gacccaggac acggagcttg tggagaccag      2040
     gcctgcaggg gatggaacct tccagaagtg ggcagctgtg gtggtacctt ctggagagga      2100
     gcagagatac acctgccatg tgcagcatga gggtctgccc aagcccctca ccctgagatg      2160
     gggtaaggag ggagatgggg gtgtcatgtc tcttagggaa agcaggagcc tctctggaga      2220
     cctttagcag ggtcagggcc cctcaccttc ccctcttttc ccagagccat cttcccagcc      2280
     caccgtcccc atcgtgggca tcattgctgg cctggttctc cttggagctg tgatcactgg      2340
     agctgtggtc gctgctgtga tgtggaggag gaacagctca ggtggagaag gggtgaaggg      2400
     tggggtctga gatttcttgt ctcactgagg gttccaagcc ccagctagaa atgtgccctg      2460
     tctcattact gggaagcacc atccacaatc atgggccgac ccagcctggg ccctgtgtgc      2520
     cagcacttac tcttttgtaa agcacctgtg acaatgaagg acagatttat caccttgatt      2580
     atggcggtga tgggacctga tcccagcagt cacaagtcac aggggaaggt ccctgacgac      2640
     agatctcagg agggcgattg gtccagggcc cacatctgct ttcttcatgt ttcctgatcc      2700
     tgccctgggt ctgcagtcac acatttctgg aaacttctct ggggtccaag actaggaggt      2760
     tcctctagga ccttaaggcc ctggctcctt tctggtatct cacaggacat tttcttccca      2820
     cagatagaaa aggagggagc tactctcagg ctgcaagtaa gtatgaagga ggctgatgcc      2880
     tgaggtcctt gggatattgt gtttgggagc ccatggggga gctcaaccac cccacaattc      2940
     ctcctctagc cacatcttct gtgggatctg accaggttct gtttttgttc taccccaggc      3000
     agtgacagtg cccagggctc tgatgtgtct ctcacagctt gtaaaggtga gagcttggag      3060
     ggcctgatgt gtgttgggtg ttgggcggaa cagtggacac agctgtgcta tggggtttct      3120
     ttgcattgga tgtattgagc atgcgatggg ctgtttaaag tgtgacccct cactgtgaca      3180
     gatatgaagt tgttcatgaa ttttttttct atagtgtgag acagctgcct tgtgtgggac      3240
     tgagaggcaa gagttgttcc tgcccttccc tttgtgactt gaagaaccct gactttgttt      3300
     ctgcaaaggc acctgcatgt gtctgtgttc atgtaggcat aatgtgagga ggtggggaga      3360
     ccaccccacc cccatgtcca ccatgaccct cttcccacgc tgacctgtgc tccct           3415
//