spacer

EBI Dbfetch

ID   EF061083; SV 1; linear; genomic DNA; STD; HUM; 1876 BP.
XX
AC   EF061083;
XX
DT   02-DEC-2006 (Rel. 90, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 2)
XX
DE   Homo sapiens MHC class I antigen (HLA) gene, HLA*240213 allele, exons 2
DE   through 5 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-1876
RA   Eller S.R., Iglehart B.S., Leffell M.S.;
RT   "Identification of a Novel Allele: A*240213";
RL   Unpublished.
XX
RN   [2]
RP   1-1876
RA   Eller S.R., Iglehart B.S., Leffell M.S.;
RT   ;
RL   Submitted (13-OCT-2006) to the INSDC.
RL   Medicine, Johns Hopkins University, 2041 E. Monument St, Baltimore, MD
RL   21205, USA
XX
DR   MD5; ec0c534bc4e7fad2f96386ae4f8d695a.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..1876
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>1876
FT                   /gene="HLA"
FT                   /allele="HLA*240213"
FT   mRNA            join(<61..330,572..847,1427..1702,1805..>1876)
FT                   /gene="HLA"
FT                   /allele="HLA*240213"
FT                   /product="MHC class I antigen"
FT   CDS             join(<61..330,572..847,1427..1702,1805..>1876)
FT                   /codon_start=3
FT                   /gene="HLA"
FT                   /allele="HLA*240213"
FT                   /product="MHC class I antigen"
FT                   /note="leukocye antigen A locus"
FT                   /db_xref="GOA:A0SXS8"
FT                   /db_xref="IMGT/HLA:A*24:02:13"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR003006"
FT                   /db_xref="InterPro:IPR003597"
FT                   /db_xref="InterPro:IPR007110"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR013783"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:A0SXS8"
FT                   /protein_id="ABK81629.1"
FT                   /translation="SHSMRYFSTSVSRPGRGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQEGPEYWDEETGKVKAHSQTDRENLRIALRYYNQSEAGSHTLQMMFGCDVGS
FT                   DGRFLRGYHQYAYDGKDYIALKEDLRSWTAADMAAQITKRKWEAAHVAEQQRAYLEGTC
FT                   VDGLRRYLENGKETLQRTDPPKTHMTHHPISDHEATLRCWALGFYPAEITLTWQRDGED
FT                   QTQDTELVETRPAGDGTFQKWAAVVVPSGEEQRYTCHVQHEGLPKPLTLRWEPSSQPTV
FT                   PIVGIIAGLVLLGAVI"
FT   exon            61..330
FT                   /gene="HLA"
FT                   /allele="HLA*240213"
FT                   /number=2
FT   exon            572..847
FT                   /gene="HLA"
FT                   /allele="HLA*240213"
FT                   /number=3
FT   exon            1427..1702
FT                   /gene="HLA"
FT                   /allele="HLA*240213"
FT                   /number=4
FT   exon            1805..>1876
FT                   /gene="HLA"
FT                   /allele="HLA*240213"
FT                   /number=5
XX
SQ   Sequence 1876 BP; 358 A; 582 C; 591 G; 345 T; 0 other;
     gacccgggaa gccgcgccgg gaggagggtc gggcgggtct cagccactcc tcgtccccag        60
     gctcccactc catgaggtat ttctccacat ccgtgtcccg gcccggccgc ggggagcccc       120
     gcttcatcgc cgtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       180
     cgagccagag gatggagccg cgggcgccgt ggatagagca ggaggggccg gagtattggg       240
     acgaggagac agggaaagtg aaggcccact cacagactga ccgagagaac ctgcggatcg       300
     cgctccgcta ctacaaccag agcgaggccg gtgagtgacc ccggcccggg gcgcaggtca       360
     cgacccctca tcccccacgg acgggccggg tcgcccacag tctccgggtc cgagatccac       420
     cccgaagccg cgggaccccg agacccttgc cccgggagag gcccaggcgc cttaacccgg       480
     tttcattttc agtttaggcc aaaaatcccc ccgggttggt cggggccggg cggggctcgg       540
     gggactgggc tgaccgcggg gtcggggcca ggttctcaca ccctccagat gatgtttggc       600
     tgcgacgtgg ggtcggacgg gcgcttcctc cgcgggtacc accagtacgc ctacgacggc       660
     aaggattaca tcgccctgaa agaggacctg cgctcttgga ccgcggcgga catggcggct       720
     cagatcacca agcgcaagtg ggaggcggcc catgtggcgg agcagcagag agcctacctg       780
     gagggcacgt gcgtggacgg gctccgcaga tacctggaga acgggaagga gacgctgcag       840
     cgcacgggta ccaggggcca cggggcgcct acctgatcgc ctgtaggtct cccgggctgg       900
     cctcccacaa ggaggggaga caattgggac caacactaga atatcgccct ccctctggtc       960
     ctgagggaga ggaatcctcc tgggtttcca gatcctgtac cagagagtga ctctgaggtt      1020
     ccgccctgct ctctgacaca attaagggat aaaatctctg acggaatgac ggaaagacga      1080
     tccctcgaat actgatgact ggttcccttt gacaccggca gcagccttgg gaccgtgact      1140
     tttcctctca ggccttgttc tctgcttcac actcaatgtg tgtgggggtc tgagtccagc      1200
     acttctgagt ccctcagcct ccactcaggt caggaccaga agtcgctgtt ccctcctcag      1260
     ggaatagaag attatcccag gtgcctgtgt ccaggctggt gtctgggttc tgtgctctct      1320
     tccccatccc gggtgtcctg tccattctca agatggccac atgcatgctg gtggagtgtc      1380
     ccatgacaga tgcaaaatgc ctgaattttc tgactcttcc cgtcagaccc ccccaagaca      1440
     catatgaccc atcaccccat ctctgaccat gaggccactc tgagatgctg ggccctgggc      1500
     ttctaccctg cggagatcac actgacctgg cagcgggatg gggaggacca gacccaggac      1560
     acggagcttg tggagaccag gcctgcaggg gatggaacct tccagaagtg ggcagctgtg      1620
     gtggtacctt ctggagagga gcagagatac acctgccatg tgcagcatga gggtctgccc      1680
     aagcccctca ccctgagatg gggtaaggag ggagatgggg gtgtcatgtc tcttagggaa      1740
     agcaggagcc tctctggaga cctttagcag ggtcagggcc cctcaccttc ccctcttttc      1800
     ccagagccat cttcccagcc caccgtcccc atcgtgggca tcattgctgg cctggttctc      1860
     cttggagctg tgatca                                                      1876
//


spacer
spacer