spacer

EBI Dbfetch

ID   EF059810; SV 1; linear; genomic DNA; STD; HUM; 811 BP.
XX
AC   EF059810;
XX
DT   12-DEC-2006 (Rel. 90, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 2)
XX
DE   Homo sapiens clone B*4801V_TZ_AE896 MHC class I antigen (HLA-B) gene, exons
DE   2, 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-811
RA   Yang K.;
RT   "A novel HLA-B allele with silent mutation";
RL   Unpublished.
XX
RN   [2]
RP   1-811
RA   Yang K.;
RT   ;
RL   Submitted (12-OCT-2006) to the INSDC.
RL   Dept. of Immunogenetics, Tzu Chi Stem Cells Centre, 707, Section 3, Chung
RL   Yang Road, Hualien 970, Taiwan
XX
DR   MD5; 0857a401e7d0d661b6f6a0aa83a27758.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..811
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /clone="B*4801V_TZ_AE896"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>811
FT                   /gene="HLA-B"
FT   mRNA            join(<11..280,526..>801)
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen"
FT   CDS             join(<11..280,526..>801)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:A1DS52"
FT                   /db_xref="IMGT/HLA:B*48:01:02"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:A1DS52"
FT                   /protein_id="ABK96991.1"
FT                   /translation="SHSMRYFYTSVSRPGRGEPRFISVGYVDDTQFVRFDSDAASPREE
FT                   PRAPWIEQEGPEYWDRETQISKTNTQTYRESLRNLRGYYNQSEAGSHTLQSMYGCDVGP
FT                   DGRLLRGHNQYAYDGKDYIALNEDLRSWTAADTAAQISQRKLEAARVAEQLRAYLEGEC
FT                   VEWLRRYLENGKDKLERA"
FT   exon            11..280
FT                   /gene="HLA-B"
FT                   /number=2
FT   exon            526..801
FT                   /gene="HLA-B"
FT                   /number=3
XX
SQ   Sequence 811 BP; 145 A; 271 C; 285 G; 110 T; 0 other;
     tcacccccag gctcccactc catgaggtat ttctacacct ccgtgtcccg gcccggccgc        60
     ggggagcccc gcttcatctc agtgggctac gtggacgaca cccagttcgt gaggttcgac       120
     agcgacgccg cgagtccgag agaggagccg cgggcgcctt ggatagagca ggaggggccg       180
     gagtattggg accgggagac acagatctcc aagaccaaca cacagactta ccgagagagc       240
     ctgcggaacc tgcgcggcta ctacaaccag agcgaggccg gtgagtgacc ccggcccggg       300
     gcgcaggtca cgactcccca tcccccacgt acggcccggg tcgccccgag tctccgggtc       360
     cgagatccgc ctccctgagg ccgcgggacc cgcccagacc ctcgaccggc gagagcccca       420
     ggcgcgttta cccggtttca ttttcagttg aggccaaaat ccccgcgggt tggtcggggc       480
     ggggcggggc tcgggggact gggctgaccg cggggccggg gccagggtct cacaccctcc       540
     agagcatgta cggctgcgac gtggggccgg acgggcgcct cctccgcggg cataaccagt       600
     acgcctacga cggcaaggat tacatcgccc tgaacgagga cctgcgctcc tggaccgccg       660
     cggacacggc ggctcagatc tcccagcgca agttggaggc ggcccgtgtg gcggagcagc       720
     tgagagccta cctggagggc gagtgcgtgg agtggctccg cagatacctg gagaacggga       780
     aggacaagct ggagcgcgct ggtaccaggg g                                      811
//


spacer
spacer