Dbfetch

ID   EF059809; SV 1; linear; genomic DNA; STD; HUM; 310 BP.
XX
AC   EF059809;
XX
DT   12-DEC-2006 (Rel. 90, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 2)
XX
DE   Homo sapiens clone DRB1*04V_TZ284741 MHC class II antigen (HLA-DRB1) gene,
DE   exon 2 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-310
RA   Yang K.;
RT   ;
RL   Submitted (12-OCT-2006) to the INSDC.
RL   Dept. of Immunogenetics, Tzu Chi Stem Cells Centre, 707, Section 3, Chung
RL   Yang Road, Hualien 970, Taiwan
XX
DR   MD5; c448e2ec7c09fd9db52e38cf63318b05.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..310
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /clone="DRB1*04V_TZ284741"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>310
FT                   /gene="HLA-DRB1"
FT   mRNA            <21..>290
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT   CDS             <21..>290
FT                   /codon_start=3
FT                   /gene="HLA-DRB1"
FT                   /product="MHC class II antigen"
FT                   /db_xref="GOA:A1DS51"
FT                   /db_xref="IMGT/HLA:DRB1*04:61"
FT                   /db_xref="InterPro:IPR000353"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR014745"
FT                   /db_xref="UniProtKB/TrEMBL:A1DS51"
FT                   /protein_id="ABK96990.1"
FT                   /translation="RFLEQVKHECHFFNGTERVRFLDRYFYHQEEYVRFDSDVGEYRAV
FT                   TELGRPDEEYWNSQKDLLEQRRAAVDTYCRHNYGVGESFTVQRR"
FT   exon            21..290
FT                   /gene="HLA-DRB1"
FT                   /number=2
XX
SQ   Sequence 310 BP; 63 A; 76 C; 116 G; 55 T; 0 other;
     gatcgttctt gtccccccag cacgtttctt ggagcaggtt aaacatgagt gtcatttctt        60
     caacgggacg gagcgggtgc ggttcctgga cagatacttc tatcaccaag aggagtacgt       120
     gcgcttcgac agcgacgtgg gggagtaccg ggcggtgacg gagctggggc ggcctgatga       180
     ggagtactgg aacagccaga aggacctcct ggagcagagg cgggccgcgg tggacaccta       240
     ctgcagacac aactacgggg ttggtgagag cttcacagtg cagcggcgag gtgagcgcgg       300
     cgcggggcgg                                                              310
//