spacer

EBI Dbfetch

ID   EF050739; SV 1; linear; genomic DNA; STD; HUM; 792 BP.
XX
AC   EF050739;
XX
DT   14-NOV-2006 (Rel. 89, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 2)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*18new allele, exons 2,
DE   3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-792
RA   Yu M., Hall J.E., Hartman K.J., Caparelli E., Smyth E., Czech J.,
RA   O'Gorman M.;
RT   "A novel HLA-B*18 allele identified by PCR-SBT in an India hematopoietic
RT   stem cell recipient and her mother";
RL   Unpublished.
XX
RN   [2]
RP   1-792
RA   Yu M., Hall J.E., Hartman K.J., Caparelli E., Smyth E., Czech J.,
RA   O'Gorman M.;
RT   ;
RL   Submitted (06-OCT-2006) to the INSDC.
RL   Histocompatibility and Immunogenetics Laboratory, Children's Memorial
RL   Hospital, 2300 Children's Plaza, Chicago, IL 60614, USA
XX
DR   MD5; 2f5651ecdbd916f25f1a755509c0c31f.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..792
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /note="PCR_primers=fwd_name: Bin1-CG, rev_name: Bin3-M13R"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>792
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*18new"
FT   mRNA            join(<1..270,517..>792)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*18new"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,517..>792)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*18new"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:A0MVW9"
FT                   /db_xref="IMGT/HLA:B*18:24"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:A0MVW9"
FT                   /protein_id="ABK41197.1"
FT                   /translation="SHSMRYFHTSVSRPGRGESRFISVGYVDGTQFVRFDSDAASPRTE
FT                   PRAPWIEQEGPEYWDRNTQISKTNTQTYRESLRNLRGYYNQSEAGSHTLQRMYGCDVGP
FT                   DGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGTC
FT                   VEWLRRHLENGKETLQRA"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*18new"
FT                   /number=2
FT   exon            517..792
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*18new"
FT                   /number=3
XX
SQ   Sequence 792 BP; 140 A; 269 C; 282 G; 101 T; 0 other;
     gctcccactc catgaggtat ttccacacct ccgtgtcccg gcccggccgc ggggagtccc        60
     gcttcatctc agtgggctac gtggacggca cccagttcgt gaggttcgac agcgacgccg       120
     cgagtccgag gacggagccc cgggcgccgt ggatagagca agaggggccg gagtattggg       180
     accggaacac acagatctcc aagaccaaca cacagactta ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg gtgagtgacc ccggcccggg gcgcaggtca       300
     cgactcccca tcccccacgt acggcccggg tcgccccgag tctccgggtc cgagatccgc       360
     ccccctgagg ccgcgggacc cgcccagacc ctcgaccggc gagagcccca ggcgcgttta       420
     cccggtttca ttttcagttg aggccaaaat ccccgcgggt tggtcggggc ggggcggggc       480
     tcggggggac ggggctgacc gcggggccgg ggccagggtc tcacaccctc cagaggatgt       540
     acggctgcga cgtggggccg gacgggcgcc tcctccgcgg gcatgaccag tccgcctacg       600
     acggcaagga ttacatcgcc ctgaacgagg acctgagctc ctggaccgcg gcggacaccg       660
     cggctcagat cacccagcgc aagtgggagg cggcccgtgt ggcggagcag ctgagagcct       720
     acctggaggg cacgtgcgtg gagtggctcc gcagacacct ggagaacggg aaggagacgc       780
     tgcagcgcgc gg                                                           792
//


spacer
spacer