spacer

EBI Dbfetch

ID   EF050037; SV 1; linear; genomic DNA; STD; HUM; 787 BP.
XX
AC   EF050037;
XX
DT   14-NOV-2006 (Rel. 89, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens MHC class I antigen (HLA-A) gene, HLA-A*3019 allele, exons 2,
DE   3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-787
RA   Hirv K., Skambraks A., Mytilineos J.;
RT   "Characterization of a new HLA-A*30 allele";
RL   Unpublished.
XX
RN   [2]
RP   1-787
RA   Hirv K., Skambraks A., Mytilineos J.;
RT   ;
RL   Submitted (06-OCT-2006) to the INSDC.
RL   Transplantation Immunology, IKT Ulm gGmbH, Helmholtzstrasse 10, Ulm 89081,
RL   Germany
XX
DR   MD5; 7376f6621a23365b73a5a1113f625bc0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..787
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>787
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*3019"
FT   mRNA            join(<1..270,512..>787)
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*3019"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,512..>787)
FT                   /codon_start=3
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*3019"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:A0MVS8"
FT                   /db_xref="IMGT/HLA:A*30:19"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:A0MVS8"
FT                   /protein_id="ABK41349.1"
FT                   /translation="SHSMRYFSTSVSRPGSGEPRFIAVGYVDDTQFVRFDSDAASQRME
FT                   PRAPWIEQERPEYWDQETRNVKAQSQTDRVDLGTLRGYHNQSEAGSHTIQIMYGCDVGS
FT                   DGRFLRGYEQHAYDGKDYIALNEDLRSWTAADMAAQITQRKWEAARWAEQLRAYLEGTC
FT                   VEWLRRYLENGKETLQRT"
FT   exon            1..270
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*3019"
FT                   /number=2
FT   variation       252
FT                   /gene="HLA-A"
FT                   /replace="t"
FT                   /note="compared to HLA-A*300101; results in His to Tyr
FT                   substitution"
FT   exon            512..787
FT                   /gene="HLA-A"
FT                   /allele="HLA-A*3019"
FT                   /number=3
XX
SQ   Sequence 787 BP; 147 A; 244 C; 281 G; 115 T; 0 other;
     gctcccactc catgaggtat ttctccacat ccgtgtcccg gcccggcagt ggagagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagccagag gatggagccg cgggcgccgt ggatagagca ggagaggcct gagtattggg       180
     accaggagac acggaatgtg aaggcccagt cacagactga ccgagtggac ctggggaccc       240
     tgcgcggcta ccacaaccag agcgaggccg gtgagtgacc ccggccgggg gcgcaggtca       300
     cgacccctca tcccccacgg acgggccagg tcgcccacag tctccgggtc cgagatccac       360
     cccgaagccg cgggaccccg agacccttga cccgggagag gcccaggcgc ctttacccgg       420
     tttcattttc agtttaggcc aaaaattccc ccgggttggt cggggctggg cggggctcgg       480
     gggactgggc tgaccgcggg gtcggggcca ggttctcaca ccatccagat aatgtatggc       540
     tgcgacgtgg ggtcggacgg gcgcttcctc cgcgggtatg aacagcacgc ctacgacggc       600
     aaggattaca tcgccctgaa cgaggacctg cgctcttgga ccgcggcgga catggcggct       660
     cagatcaccc agcgcaagtg ggaggcggcc cgttgggcgg agcagttgag agcctacctg       720
     gagggcacgt gcgtggagtg gctccgcaga tacctggaga acgggaagga gacgctgcag       780
     cgcacgg                                                                 787
//


spacer
spacer