Dbfetch

ID   EF025768; SV 1; linear; genomic DNA; STD; HUM; 846 BP.
XX
AC   EF025768;
XX
DT   01-NOV-2006 (Rel. 89, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*44 variant allele,
DE   exons 2, 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-846
RA   Abdeen H., Mcerlean C., Moraes M.E., Middleton D.;
RT   "Identification of two novel HLA-B variant alleles";
RL   Unpublished.
XX
RN   [2]
RP   1-846
RA   Abdeen H., Mcerlean C., Moraes M.E., Middleton D.;
RT   ;
RL   Submitted (25-SEP-2006) to the INSDC.
RL   Histocompatibility and Immunogenetics, Belfast City Hospital, Lisburn Road,
RL   Belfast BT9 7TS, UK
XX
DR   MD5; e7e67cab3f42ea65da5bcd81c8845d2a.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..846
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>846
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*44 variant"
FT   mRNA            join(<35..304,548..>823)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*44 variant"
FT                   /product="MHC class I antigen"
FT   CDS             join(<35..304,548..>823)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*44 variant"
FT                   /product="MHC class I antigen"
FT                   /db_xref="IMGT/HLA:B*44:50:01"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="UniProtKB/TrEMBL:A0FKC5"
FT                   /protein_id="ABK20870.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFITVGYVDDTLFVRFDSDATSPRKE
FT                   PRAPWIEQEGPEYWDRETQISKTNTQTYRENLRIALRYYNQSEAGSHIIQRMYGCDVGP
FT                   DGRLLRGYDQDAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGLC
FT                   VESLRRYLENGKETLQRA"
FT   exon            35..304
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*44 variant"
FT                   /number=2
FT   variation       270
FT                   /gene="HLA-B"
FT                   /replace="c"
FT                   /note="compared to HLA-B*440301 allele"
FT   variation       272
FT                   /gene="HLA-B"
FT                   /replace="c"
FT                   /note="compared to HLA-B*440301 allele"
FT   exon            548..823
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*44 variant"
FT                   /number=3
XX
SQ   Sequence 846 BP; 149 A; 283 C; 303 G; 111 T; 0 other;
     ggtcgggcgg gtctcagccc ctcctcgccc ccaggctccc actccatgag gtatttctac        60
     accgccatgt cccggcccgg ccgcggggag ccccgcttca tcaccgtggg ctacgtggac       120
     gacacgctgt tcgtgaggtt cgacagcgac gccacgagtc cgaggaagga gccgcgggcg       180
     ccatggatag agcaggaggg gccggagtat tgggaccggg agacacagat ctccaagacc       240
     aacacacaga cttaccgaga gaacctgcgg atcgcgctcc gctactacaa ccagagcgag       300
     gccggtgagt gaccccggcc cggggcgcag gtcacgactc cccatccccc acgtacggcc       360
     cgggtcgccc cgagtctccg ggtccgagat ccgcccccga ggccgcggga cccgcccaga       420
     ccctcgaccg gcgagagccc caggcgcgtt tacccggttt cattttcagt tgaggccaaa       480
     atccccgcgg gttggtcggg gcggggcggg gctcggggga cggggctgac cgcggggccg       540
     gggccagggt ctcacatcat ccagaggatg tacggctgcg acgtggggcc ggacgggcgc       600
     ctcctccgcg ggtatgacca ggacgcctac gacggcaagg attacatcgc cctgaacgag       660
     gacctgagct cctggaccgc ggcggacacc gcggctcaga tcacccagcg caagtgggag       720
     gcggcccgtg tggcggagca gctgagagcc tacctggagg gcctgtgcgt ggagtcgctc       780
     cgcagatacc tggagaacgg gaaggagacg ctgcagcgcg cgggtaccag gggcagtggg       840
     gagcct                                                                  846
//