spacer

EBI Dbfetch

ID   EF025767; SV 1; linear; genomic DNA; STD; HUM; 862 BP.
XX
AC   EF025767;
XX
DT   01-NOV-2006 (Rel. 89, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 3)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*35 variant allele,
DE   exons 2, 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-862
RA   Abdeen H., Mcerlean C., Moraes M.E., Middleton D.;
RT   "Identification of two novel HLA-B variant alleles";
RL   Unpublished.
XX
RN   [2]
RP   1-862
RA   Abdeen H., Mcerlean C., Moraes M.E., Middleton D.;
RT   ;
RL   Submitted (25-SEP-2006) to the INSDC.
RL   Histocompatibility and Immunogenetics, Belfast City Hospital, Lisburn Road,
RL   Belfast BT9 7TS, UK
XX
DR   MD5; b11dc6a5e8b4ea1ad3e214ff65a119e0.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..862
FT                   /organism="Homo sapiens"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>862
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*35 variant"
FT   mRNA            join(<44..313,559..>834)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*35 variant"
FT                   /product="MHC class I antigen"
FT   CDS             join(<44..313,559..>834)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*35 variant"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:A0FKC4"
FT                   /db_xref="IMGT/HLA:B*35:69"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:A0FKC4"
FT                   /protein_id="ABK20869.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRTE
FT                   PRAPWIEQEGPEYWDRETQIFKTNTQTDRESLRNLRGYYNQSEAGSHIIQRMYGCDLGP
FT                   DGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGLC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            44..313
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*35 variant"
FT                   /number=2
FT   variation       262
FT                   /gene="HLA-B"
FT                   /replace="t"
FT                   /note="compared to HLA-B*3510 allele"
FT   exon            559..834
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*35 variant"
FT                   /number=3
XX
SQ   Sequence 862 BP; 150 A; 290 C; 310 G; 112 T; 0 other;
     cgggaggagg gtcgggcggg tctcagcccc tcctcgcccc caggctccca ctccatgagg        60
     tatttctaca ccgccatgtc ccggcccggc cgcggggagc cccgcttcat cgcagtgggc       120
     tacgtggacg acacccagtt cgtgaggttc gacagcgacg ccgcgagtcc gaggacggag       180
     ccccgggcgc catggataga gcaggagggg ccggagtatt gggaccggga gacacagatc       240
     ttcaagacca acacacagac tgaccgagag agcctgcgga acctgcgcgg ctactacaac       300
     cagagcgagg ccggtgagtg accccggccc ggggcgcagg tcacgactcc ccatccccca       360
     cgtacggccc gggtcgcccc gagtctccgg gtccgagatc cgcctccctg aggccgcggg       420
     acccgcccag accctcgacc ggcgagagcc ccaggcgcgt ttacccggtt tcattttcag       480
     ttgaggccaa aatccccgcg ggttggtcgg ggcggggcgg ggctcggggg acggggctga       540
     ccgcggggcc ggggccaggg tctcacatca tccagaggat gtatggctgc gacctggggc       600
     ccgacgggcg cctcctccgc gggcatgacc agtccgccta cgacggcaag gattacatcg       660
     ccctgaacga ggacctgagc tcctggaccg cggcggacac cgcggctcag atcacccagc       720
     gcaagtggga ggcggcccgt gtggcggagc agctgagagc ctacctggag ggcctgtgcg       780
     tggagtggct ccgcagatac ctggagaacg ggaaggagac gctgcagcgc gcgggtacca       840
     ggggcagtgg ggagcctccc ca                                                862
//


spacer
spacer