Dbfetch

ID   DQ985229; SV 1; linear; genomic DNA; STD; HUM; 811 BP.
XX
AC   DQ985229;
XX
DT   10-OCT-2006 (Rel. 89, Created)
DT   23-MAR-2009 (Rel. 100, Last updated, Version 4)
XX
DE   Homo sapiens MHC class I antigen (HLA-B) gene, HLA-B*4601 variant allele,
DE   exons 2, 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-811
RX   DOI; 10.1111/j.1399-0039.2009.01222.x.
RX   PUBMED; 19317750.
RA   Chu C.C., Lee H.L., Lin M.;
RT   "Identification of a novel HLA-B allele, B*460102, in three Taiwanese
RT   individuals";
RL   Tissue Antigens 73(4):374-375(2009).
XX
RN   [2]
RP   1-811
RA   Chu C.-C.;
RT   ;
RL   Submitted (05-SEP-2006) to the INSDC.
RL   Medical Research Department, Mackay Memorial Hospital, Taipei, Taiwan
XX
DR   MD5; 844567ca540ad3c97862eeb575113e40.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..811
FT                   /organism="Homo sapiens"
FT                   /chromosome="6"
FT                   /map="6p21.3"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>811
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4601 variant"
FT                   /note="silent mutation"
FT   mRNA            join(<11..280,526..>801)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4601 variant"
FT                   /product="MHC class I antigen"
FT   CDS             join(<11..280,526..>801)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4601 variant"
FT                   /product="MHC class I antigen"
FT                   /db_xref="IMGT/HLA:B*46:01:02"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR037055"
FT                   /db_xref="UniProtKB/TrEMBL:Q000Z0"
FT                   /protein_id="ABJ09708.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRMA
FT                   PRAPWIEQEGPEYWDRETQKYKRQAQTDRVSLRNLRGYYNQSEAGSHTLQRMYGCDVGP
FT                   DGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAAREAEQWRAYLEGLC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            11..280
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4601 variant"
FT                   /number=2
FT   exon            526..801
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*4601 variant"
FT                   /number=3
XX
SQ   Sequence 811 BP; 142 A; 269 C; 295 G; 105 T; 0 other;
     tcgcccccag gctcccactc catgaggtat ttctacaccg ccatgtcccg gcccggccgc        60
     ggggagcccc gcttcatcgc agtgggctac gtggacgaca cccagttcgt gaggttcgac       120
     agcgacgccg cgagtccgag gatggcgccc cgggcgccat ggatagagca ggaggggccg       180
     gagtattggg accgggagac acagaagtac aagcgccagg cacagactga tcgagtgagc       240
     ctgcggaacc tgcgcggcta ctacaaccag agcgaggccg gtgagtgacc ccggcctggg       300
     gcgcaggtca cgactcccca tcccccacgt acggcccggg tcgccccgag tctccgggtc       360
     cgagatccgc ccccctgagg ccgcgggacc cgcccaaacc ctcgaccggc gagagcccca       420
     ggcgcgttta cccggtttca ttttcagttg aggccaaaat ccccgcgggt tggtcggggc       480
     ggggcggggc tcgggggacg gggctgaccg cggggcctgg gccagggtct cacaccctcc       540
     agaggatgta cggctgcgac gtggggccgg acgggcgcct cctccgcggg catgaccagt       600
     ccgcctacga cggcaaggat tacatcgccc tgaacgagga cctgagctcc tggaccgcgg       660
     cggacacggc ggctcagatc acccagcgca agtgggaggc ggcccgtgag gcggagcagt       720
     ggagagccta cctggagggc ctgtgcgtgg agtggctccg cagatacctg gagaacggga       780
     aggagacgct gcagcgcgcg ggtaccaggg g                                      811
//