spacer

EBI Dbfetch

ID   DQ984200; SV 1; linear; genomic DNA; STD; HUM; 790 BP.
XX
AC   DQ984200;
XX
DT   15-OCT-2006 (Rel. 89, Created)
DT   17-JUN-2008 (Rel. 96, Last updated, Version 4)
XX
DE   Homo sapiens isolate BY00134 MHC class I antigen (HLA-B) gene, HLA-B*5406
DE   variant allele, exons 2, 3 and partial cds.
XX
KW   .
XX
OS   Homo sapiens (human)
OC   Eukaryota; Metazoa; Chordata; Craniata; Vertebrata; Euteleostomi; Mammalia;
OC   Eutheria; Euarchontoglires; Primates; Haplorrhini; Catarrhini; Hominidae;
OC   Homo.
XX
RN   [1]
RP   1-790
RX   DOI; 10.1111/j.1399-0039.2007.00905.x.
RX   PUBMED; 17767563.
RA   Li J., Lazaro A.M., Xiao Y., Ng J., Hurley C.K.;
RT   "Identification of two new HLA-B alleles, HLA-B*4069 and B*5409, in the
RT   Liaoning province of China";
RL   Tissue Antigens 70(4):345-346(2007).
XX
RN   [2]
RP   1-790
RA   Lazaro A.M., Xiao Y., Li J., Hurley C.K.;
RT   "Novel HLA class I allele";
RL   Unpublished.
XX
RN   [3]
RP   1-790
RA   Lazaro A.M., Xiao Y., Li J., Hurley C.K.;
RT   ;
RL   Submitted (05-SEP-2006) to the INSDC.
RL   Oncology, Georgetown University, 3970 Reservoir Rd, N.W., Washington, DC
RL   20057, USA
XX
DR   MD5; 5e56f6cff86351f00faf2a3b22401ce6.
XX
FH   Key             Location/Qualifiers
FH
FT   source          1..790
FT                   /organism="Homo sapiens"
FT                   /isolate="BY00134"
FT                   /mol_type="genomic DNA"
FT                   /db_xref="taxon:9606"
FT   gene            <1..>790
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5406 variant"
FT   mRNA            join(<1..270,516..>790)
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5406 variant"
FT                   /product="MHC class I antigen"
FT   CDS             join(<1..270,516..>790)
FT                   /codon_start=3
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5406 variant"
FT                   /product="MHC class I antigen"
FT                   /db_xref="GOA:Q001P1"
FT                   /db_xref="IMGT/HLA:B*54:09"
FT                   /db_xref="InterPro:IPR001039"
FT                   /db_xref="InterPro:IPR011161"
FT                   /db_xref="InterPro:IPR011162"
FT                   /db_xref="InterPro:IPR027648"
FT                   /db_xref="UniProtKB/TrEMBL:Q001P1"
FT                   /protein_id="ABJ52523.1"
FT                   /translation="SHSMRYFYTAMSRPGRGEPRFIAVGYVDDTQFVRFDSDAASPRGE
FT                   PRAPWVEQEGPEYWDRNTQIYKAQAQTDRESLRNLRGYYNQSEAGSHTLQRMYGCDVGP
FT                   DGRLLRGHDQSAYDGKDYIALNEDLSSWTAADTAAQITQRKWEAARVAEQLRAYLEGTC
FT                   VEWLRRYLENGKETLQRA"
FT   exon            1..270
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5406 variant"
FT                   /number=2
FT   gap             271..515
FT                   /estimated_length=245
FT   exon            516..>790
FT                   /gene="HLA-B"
FT                   /allele="HLA-B*5406 variant"
FT                   /number=3
XX
SQ   Sequence 790 BP; 106 A; 173 C; 198 G; 68 T; 245 other;
     gctcccactc catgaggtat ttctacaccg ccatgtcccg gcccggccgc ggggagcccc        60
     gcttcatcgc agtgggctac gtggacgaca cgcagttcgt gcggttcgac agcgacgccg       120
     cgagtccgag aggggagccg cgggcgccgt gggtggagca ggaggggccg gagtattggg       180
     accggaacac acagatctac aaggcccagg cacagactga ccgagagagc ctgcggaacc       240
     tgcgcggcta ctacaaccag agcgaggccg nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       300
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       360
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       420
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn       480
     nnnnnnnnnn nnnnnnnnnn nnnnnnnnnn nnnnnggtct cacaccctcc agaggatgta       540
     cggctgcgac gtggggccgg acgggcgcct cctccgcggg catgaccagt ccgcctacga       600
     cggcaaggat tacatcgccc tgaacgagga cctgagctcc tggaccgcgg cggacaccgc       660
     ggctcagatc acccagcgca agtgggaggc ggcccgtgtg gcggagcagc tgagagccta       720
     cctggagggc acgtgcgtgg agtggctccg cagatacctg gagaacggga aggagacgct       780
     gcagcgcgcg                                                              790
//


spacer
spacer